A2RU37 CI170_HUMAN

Gene name: LINC02872
Protein name: Uncharacterized protein encoded by LINC02872

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96K21 ZFYVE19 0.68725 anatomical structure development GO:0048856
cell cycle GO:0007049
cell division GO:0051301
...
2 P43116 PTGER2 0.68695 cell population proliferation GO:0008283
circulatory system process GO:0003013
homeostatic process GO:0042592
...
3 Q9H2U1 DHX36 0.65623 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
4 Q5M8T2 SLC35D3 0.63586 homeostatic process GO:0042592
protein transport GO:0015031
transport GO:0006810
5 Q5J8M3 EMC4 0.59551 cell death GO:0008219
6 P98168 ZXDA 0.59477 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 Q9NZI8 IGF2BP1 0.59315 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 P10301 RRAS 0.59166 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
9 Q9HCR9 PDE11A 0.58041 signal transduction GO:0007165
10 Q9UKL4 GJD2 0.5702 cell-cell signaling GO:0007267
nervous system process GO:0050877

                                           20                  40                  60                  80                 100
AA:                      MWSRRGLGVSRAPLHLLLGVWGPSGRTGGQRKGASLARPGRGGLASCSVGANGKRDVLFLRKTLTNTVEDIQIDNFRRKSDLGVGSPDWKNLLIDVTRED
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDD....................DDDDDDDD................................................................
DO_IUPRED2A:             ...........................DDDDDDDDDDDDD....DDD...............................................DDDDDD
DO_SPOTD:                DDDDDDDDDD............DDDDDDDDDDDDDDDDDDDDD...................................DDD.D.D............DDD
CONSENSUS:               DDDDDDDD...................DDDDDDDDDDDDD.........................................................DDD
CONSENSUS_MOBI:          .......................DDDDDDDDDDDDDDDDDDDD........................................................D
RICH_MOBI_[G]:                                   GrtGGqrkGaslarpGrGG                                                         
RICH_MOBI_[R]:                                    RtggqRkgaslaRpgR                                                           
RICH_MOBI_[GR]:                                  GRtGGqRkGaslaRpGRGG                                                         
RICH_fLPS_MOBI_[G]:                             sGrtGGqrkGaslarpGrGG                                                         

                                          120                   
AA:                      HENSQNNSKRRCKVNCETDQR
STMI:                                         
DO_DISOPRED3:            DD..DDDDD..DDDD....DD
DO_IUPRED2A:             D.DDDDDDDDDDDDDDD....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDD
RICH_[N]:                  NsqNNskrrckvN      
RICH_[CN]:                 NsqNNskrrCkvNC     
RICH_MOBI_[N]:             NsqNNskrrckvN      
RICH_MOBI_[CN]:            NsqNNskrrCkvNC