Q5J8M3 EMC4_HUMAN
Gene name: EMC4
Protein name: ER membrane protein complex subunit 4
List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P10301 | RRAS | 0.8963 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 2 | Q6ZRY4 | RBPMS2 | 0.85518 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 3 | Q8IV45 | UNC5CL | 0.8543 | cellular protein modification process GO:0006464 response to stress GO:0006950 signal transduction GO:0007165 |
| 4 | Q6P575 | GUSBP11 | 0.84842 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 5 | O96011 | PEX11B | 0.84032 | signal transduction GO:0007165 |
| 6 | Q6XUX3 | DSTYK | 0.83665 | cell death GO:0008219 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 7 | Q9Y5Y6 | ST14 | 0.8333 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 8 | Q8TDH9 | BLOC1S5 | 0.82615 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cytoskeleton-dependent intracellular transport GO:0030705 ... |
| 9 | Q96KJ9 | COX4I2 | 0.82592 | generation of precursor metabolites and energy GO:0006091 response to stress GO:0006950 |
| 10 | Q9H2U1 | DHX36 | 0.82326 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTM STMI: MMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDD.............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................ DO_IUPRED2A: .........................DDDDDDDDDDD................................................................ DO_SPOTD: DDDDDDDDDDDD...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................... CONSENSUS: DDDDDDDDDDDD.............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................... CONSENSUS_MOBI: ...................DDDDDDDDDDDDDDDDDDDD............................................ RICH_[G]: GGsrGrsdrGsGqGdslypvG RICH_[DY]: DslYpvgYlDkqvpD RICH_[GR]: GGsRGRsdRGsG RICH_[GY]: GrsdrGsGqGdslYpvGY RICH_fLPS_[G]: GGsrGrsdrGsGqGdslypvG RICH_MOBI_[G]: GpGGGsrGrsdrGsGqG RICH_MOBI_[GR]: GGGsRGRsdRGsG RICH_fLPS_MOBI_[G]: elsGpGGGsrGrsdrGsGqG
120 140 160 180 AA: MVCMMAWRPIQALMAISATFKMLESSSQKFLQGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGLLL STMI: MMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ................................................................................... DO_IUPRED2A: ................................................................................... DO_SPOTD: .............................................................................DDDDDD CONSENSUS: ......................... ................................. CONSENSUS_MOBI: ......................... .................................