A4QMS7 CE049_HUMAN

Gene name: C5orf49
Protein name: Uncharacterized protein C5orf49

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q13231 CHIT1 0.90114 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
immune system process GO:0002376
...
2 Q99576 TSC22D3 0.8804 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
3 Q5VTD9 GFI1B 0.87137 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
4 Q6UX34 SNORC 0.8672 anatomical structure development GO:0048856
5 Q96FZ7 CHMP6 0.8596 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cell cycle GO:0007049
...
6 Q4KMG9 TMEM52B 0.85907
7 Q9H5V8 CDCP1 0.82835
8 Q8N967 LRTM2 0.81375 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
9 Q9NS82 SLC7A10 0.8078 immune system process GO:0002376
transport GO:0006810
10 Q7L3V2 RTL10 0.80513 cell death GO:0008219
membrane organization GO:0061024
signal transduction GO:0007165
...

                                           20                  40                  60                  80                 100
AA:                      MEDDEEETTASTLRGKPRPPPVSAQSAFSYIPPRRLDPKEHSYYYRPARTGIISLYDCIFKRRLDYDQKLHRDDREHAKSLGLHVNEEEQERPVGVLTSS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDD......................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......DD...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................D..D.......................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......DD...............................DDDD.......................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................
RICH_[P]:                                PrPPPvsaqsafsyiPP                                                                   
RICH_[EP]:                EddEEEttastlrgkPrPPP                                                                               
RICH_MOBI_[P]:                           PrPPPvsaqsafsyiPP                                                                   

                                          120                 140             
AA:                      VYGKRINQPIEPLNRDFGRANHVQADFYRKNDIPSLKEPGFGHIAPS
STMI:                                                                   
DO_DISOPRED3:            .............................................DD
DO_IUPRED2A:             ...........DDDDDD.....................DDD..D..D
DO_SPOTD:                ...............................DDDDDDDDDDDDDDDD
CONSENSUS:               ......................................DDDDDDDDD
CONSENSUS_MOBI:          ...............................................