Q96FZ7 CHMP6_HUMAN
Gene name: CHMP6
Protein name: Charged multivesicular body protein 6
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell division GO:0051301
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- chromosome segregation GO:0007059
- membrane organization GO:0061024
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q4KMG9 | TMEM52B | 0.99763 | |
| 2 | Q9NX14 | NDUFB11 | 0.86362 | cellular component assembly GO:0022607 generation of precursor metabolites and energy GO:0006091 protein-containing complex assembly GO:0065003 |
| 3 | A4QMS7 | C5orf49 | 0.8596 | |
| 4 | Q86XJ0 | CALHM3 | 0.80769 | cellular component assembly GO:0022607 nervous system process GO:0050877 protein-containing complex assembly GO:0065003 |
| 5 | Q13231 | CHIT1 | 0.79586 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 immune system process GO:0002376 ... |
| 6 | Q9Y676 | MRPS18B | 0.7601 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 7 | Q99576 | TSC22D3 | 0.74626 | biosynthetic process GO:0009058 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | Q9BT04 | FUZ | 0.74524 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 9 | Q6PXP3 | SLC2A7 | 0.74524 | transmembrane transport GO:0055085 transport GO:0006810 |
| 10 | Q8NAA4 | ATG16L2 | 0.74524 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
20 40 60 80 100 AA: MGNLFGRKKQSRVTEQDKAILQLKQQRDKLRQYQKRIAQQLERERALARQLLRDGRKERAKLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEMKV STMI: DO_DISOPRED3: DDDDDDDDDDDD........................................................................................ DO_IUPRED2A: .D....DDD........................................................................................... DO_SPOTD: DDDDDDDDDDDDDD...................................................................................... CONSENSUS: DDDDDDDDDDDD........................................................................................ CONSENSUS_MOBI: .............................................DDD....................................................
120 140 160 180 200 AA: MEGLQFGNECLNKMHQVMSIEEVERILDETQEAVEYQRQIDELLAGSFTQEDEDAILEELSAITQEQIELPEVPSEPLPEKIPENVPVKARPRQAELVAA STMI: DO_DISOPRED3: .....................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .......................................................DD.D.......DDDDDDDDDDDDDDDDDDDDD.D...D....... DO_SPOTD: ..............................................DDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .......................................................DD.D.......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................DD............DD................... RICH_[P]: PevPsePlPekiPenvP RICH_[EP]: ElPEvPsEPlPEkiPEnvP
AA: S STMI: DO_DISOPRED3: D DO_IUPRED2A: . DO_SPOTD: D CONSENSUS: D CONSENSUS_MOBI: .