A6NDX4 YO011_HUMAN

Protein name: Putative transmembrane protein ENSP00000320207

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NY25 CLEC5A 0.72542 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
2 Q96IQ7 VSIG2 0.70711
3 Q9H8K7 PAAT 0.6117
4 P06028 GYPB 0.60921 immune system process GO:0002376
5 Q86VL8 SLC47A2 0.58139 transmembrane transport GO:0055085
transport GO:0006810
6 A8K4G0 CD300LB 0.57735 immune system process GO:0002376
response to stress GO:0006950
7 P03999 OPN1SW 0.5588 cellular protein modification process GO:0006464
nervous system process GO:0050877
signal transduction GO:0007165
8 O95292 VAPB 0.54087 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
homeostatic process GO:0042592
...
9 Q8IZV2 CMTM8 0.53567 anatomical structure development GO:0048856
10 Q5T7R7 C1orf185 0.51574

                                           20                  40                  60                  80                 100
AA:                      MYVSISFLLGLSHLVLCCLLTFIVNFYLPPESIDFEFMAHNWSKGRSPSSTLGLSWFKAGFRFSDGWSMFYSSGLPGVALPGSPPRSHLLPGTQILIRSF
STMI:                      MMMMMMMMMMMMMMMMMMMMM                                                                             
DO_DISOPRED3:            DD.D................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ..                     .............................................................................
CONSENSUS_MOBI:          ..                     .............................................................................

                                          120                
AA:                      QPCESAKHSARLSSLLTTTSYSVS
STMI:                                            
DO_DISOPRED3:            ..........DDDDDDDDDDDDDD
DO_IUPRED2A:             ........................
DO_SPOTD:                .....DDDDDDDDDDDDDDDDDDD
CONSENSUS:               ..........DDDDDDDDDDDDDD
CONSENSUS_MOBI:          ........................
RICH_[ST]:                           SSllTTTSyS