A6NFY7 SDHF1_HUMAN

Gene name: SDHAF1
Protein name: Succinate dehydrogenase assembly factor 1, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O00400 SLC33A1 0.76406 signal transduction GO:0007165
transmembrane transport GO:0055085
transport GO:0006810
2 Q8N344 MIER2 0.70671 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
3 O14734 ACOT8 0.70217 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
4 Q9Y5S1 TRPV2 0.70163 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
5 Q9H6X4 TMEM134 0.65245 biological process involved in symbiotic interaction GO:0044403
6 Q96Q91 SLC4A9 0.64662 homeostatic process GO:0042592
transport GO:0006810
7 Q9H2V7 SPNS1 0.6405 transport GO:0006810
8 O75127 PTCD1 0.62542 cellular nitrogen compound metabolic process GO:0034641
9 Q13217 DNAJC3 0.61663 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
10 P54826 GAS1 0.61026 cell cycle GO:0007049
cell death GO:0008219
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MSRHSRLQRQVLSLYRDLLRAGRGKPGAEARVRAEFRQHAGLPRSDVLRIEYLYRRGRRQLQLLRSGHATAMGAFVRPRAPTGEPGGVGCQPDDGDSPRN
STMI:                                                                                                                        
DO_DISOPRED3:            D.............................................................................DDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDD..D..........DDD..DDDDDDDDDDDDDDDDD.D.....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDD..............................................................DDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDD..............................................................DDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .........................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[D]:                                                                                                            DDgDsprn
RICH_[G]:                                                                                                  GepGGvGcqpddG     
RICH_[DG]:                                                                                                 GepGGvGcqpDDGDsprn
RICH_[DP]:                                                                                                   PggvgcqPDDgDsPrn
RICH_[GP]:                                                                                            PraPtGePGGvGcqPddGdsPrn
RICH_MOBI_[D]:                                                                                                       DDgDsprn
RICH_MOBI_[G]:                                                                                             GepGGvGcqpddG     
RICH_MOBI_[DG]:                                                                                            GepGGvGcqpDDGDsprn

                              
AA:                      PHDSTGAPETRPDGR
STMI:                                   
DO_DISOPRED3:            DDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDD
RICH_[D]:                phDstgapetrpD  
RICH_[DG]:               phDstG         
RICH_[DP]:               PhD            
RICH_[GP]:               P              
RICH_MOBI_[D]:           phDstgapetrpD  
RICH_MOBI_[DG]:          phDstG