Q9H6X4 TM134_HUMAN

Gene name: TMEM134
Protein name: Transmembrane protein 134

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y5S1 TRPV2 0.74015 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
2 O75127 PTCD1 0.68533 cellular nitrogen compound metabolic process GO:0034641
3 Q96JB5 CDK5RAP3 0.66684 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
4 A6NFY7 SDHAF1 0.65245 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
5 O00400 SLC33A1 0.62957 signal transduction GO:0007165
transmembrane transport GO:0055085
transport GO:0006810
6 Q9Y337 KLK5 0.60642 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell death GO:0008219
...
7 Q9NRX5 SERINC1 0.60151 biosynthetic process GO:0009058
8 Q9BRT9 GINS4 0.60009 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell population proliferation GO:0008283
...
9 Q8N344 MIER2 0.59264 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
10 P48723 HSPA13 0.58608 protein folding GO:0006457
response to stress GO:0006950
transport GO:0006810
...

                                           20                  40                  60                  80                 100
AA:                      MSAARPQFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD......................DD.........DDD.................D...........D.D.DDDDD..D....D.DD..........
DO_IUPRED2A:             DDD.D.....DDDDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDD.....DDDDDDDDDDDDDDDDDDDDDDD.....DDD.............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............
RICH_[RS]:                                                                                              RdSSRtSiRS           
RICH_[D]:                                                                              DeDgaqaspepDggvgtrD                   
RICH_[DG]:                                                                             DeDGaqaspepDGGvGtrD                   
RICH_MOBI_[D]:                                                          DeDkqsrlryqnlenDeD                                   
RICH_MOBI_[DF]:                 FsiDDaFelsleD                                                                                
RICH_MOBI_[DG]:                                                                        DeDGaqaspepDGGvGtrD                   
RICH_MOBI_[FG]:                       FelsledGGpGpessGvarF                                                                   

                                          120                 140                 160                 180     
AA:                      TQRSYNTCCSWTQHPLIQKNRRVVLASFLLLLLGLVLILVGVGLEATPSPGVSSAIFFVPGFLLLVPGVYHVIFIYCAVKGHRGFQFFYLPYFEK
STMI:                                          MMMMMMMMMMMMMMMMMMMMM           MMMMMMMMMMMMMMMMMMMMM                    
DO_DISOPRED3:            ...............................................................................................
DO_IUPRED2A:             ...............................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................
CONSENSUS:               ......................                     ...........                     ....................
CONSENSUS_MOBI:          ......................                     ...........                     ....................