A6NKN8 PC4L1_HUMAN

Gene name: PCP4L1
Protein name: Purkinje cell protein 4-like protein 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O75844 ZMPSTE24 0.69035 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
2 Q13045 FLII 0.68318 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
3 A8MU46 SMTNL1 0.67077 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
4 P20962 PTMS 0.65877 biosynthetic process GO:0009058
immune system process GO:0002376
5 Q03169 TNFAIP2 0.65807 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
6 Q15506 SPA17 0.65786 reproduction GO:0000003
transport GO:0006810
7 Q99547 MPHOSPH6 0.65573 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
8 Q969H6 POP5 0.655 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
9 P07196 NEFL 0.65438 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
10 Q8N239 KLHL34 0.6457

                                           20                  40                  60            
AA:                      MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS
STMI:                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................DDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............DDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............DDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................
RICH_[AE]:                             AAgqEEkgkAgnvkkAEEEE                                  
RICH_[AK]:                         AtnqAAgqeeKgKAgnvKKA                                      
RICH_[E]:                                  EEkgkagnvkkaEEEEE                                 
RICH_[EK]:                                 EEKgKagnvKKaEEEEE                                 
RICH_fLPS_[E]:                          agqEEkgkagnvkkaEEEEE                                 
RICH_MOBI_[AE]:                        AAgqEEkgkAgnvkkAEEEE                                  
RICH_MOBI_[AK]:                    AtnqAAgqeeKgKAgnvKKA                                      
RICH_MOBI_[E]:                             EEkgkagnvkkaEEEEEididltapE                        
RICH_MOBI_[EI]:                            EEkgkagnvkkaEEEEEIdIdltapE                        
RICH_MOBI_[EK]:                            EEKgKagnvKKaEEEEE                                 
RICH_MOBI_[IK]:                              KgKagnvKKaeeeeeIdI                              
RICH_fLPS_MOBI_[E]:                               nvkkaEEEEE