Q969H6 POP5_HUMAN
Gene name: POP5
Protein name: Ribonuclease P/MRP protein subunit POP5
List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- ribosome biogenesis GO:0042254
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P68371 | TUBB4B | 0.9762 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 2 | Q8N239 | KLHL34 | 0.96843 | |
| 3 | P59044 | NLRP6 | 0.94943 | catabolic process GO:0009056 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 4 | Q96DX7 | TRIM44 | 0.90854 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q9UK22 | FBXO2 | 0.90496 | catabolic process GO:0009056 cell population proliferation GO:0008283 cellular protein modification process GO:0006464 ... |
| 6 | P10645 | CHGA | 0.88061 | cell death GO:0008219 cell-cell signaling GO:0007267 circulatory system process GO:0003013 ... |
| 7 | Q8N4Q1 | CHCHD4 | 0.87698 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 protein folding GO:0006457 ... |
| 8 | Q8NCJ5 | SPRYD3 | 0.86952 | cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 9 | A0PJX2 | TLDC2 | 0.86738 | cell death GO:0008219 response to stress GO:0006950 |
| 10 | A6NIN4 | RNF227 | 0.86643 |
20 40 60 80 100 AA: MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCRKEFYQLVWSALPFITYLENKGHRYPCFFNT STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDD................................................................................................. CONSENSUS: .................................................................................................... CONSENSUS_MOBI: D...................................................................................................
120 140 160 AA: LHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQKSVTRSCLLEEEEESGEEAAEAME STMI: DO_DISOPRED3: ...............................................DDDDDDDDDDDDDDDD DO_IUPRED2A: .........................................................DDDDDD DO_SPOTD: ............................................DDDDDDDDDDDDDDDDDDD CONSENSUS: ...............................................DDDDDDDDDDDDDDDD CONSENSUS_MOBI: ................................................DDDDDDDDDDDDDDD RICH_[AE]: EEsgEEAAEAmE RICH_[E]: EEEEEsgEEaaEamE RICH_fLPS_[E]: EEEEEsgEEaaEamE RICH_MOBI_[AE]: EEsgEEAAEAmE RICH_MOBI_[E]: EEEEEsgEEaaEamE RICH_fLPS_MOBI_[E]: EEEEEsgEEaaEamE