A6PVL3 KNCN_HUMAN

Gene name: KNCN
Protein name: Kinocilin

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q92930 RAB8B 0.78935 cell junction organization GO:0034330
cell-cell signaling GO:0007267
immune system process GO:0002376
...
2 Q6ZRR7 LRRC9 0.68636
3 A8MWK0 FADS2B 0.62955 biosynthetic process GO:0009058
small molecule metabolic process GO:0044281
4 O00194 RAB27B 0.61859 cytoskeleton-dependent intracellular transport GO:0030705
protein transport GO:0015031
signal transduction GO:0007165
...
5 Q9HAT8 PELI2 0.61394 cellular protein modification process GO:0006464
signal transduction GO:0007165
6 Q6IQ21 ZNF770 0.60692
7 Q13526 PIN1 0.55816 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 Q4KMG0 CDON 0.48934 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
9 P07550 ADRB2 0.44934 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
10 Q9NUV7 SPTLC3 0.44801 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281

                                           20                  40                  60                  80                 100
AA:                      MDIPISSRDFRGLQLACVALGLVAGSIIIGISVSKAAAAMGGVFIGAAVLGLLILAYPFLKARFNLDHILPTIGSLRIHPHPGADHGEGRSSTNGNKEGA
STMI:                                MMMMMMMMMMMMMMMMMMMMM      MMMMMMMMMMMMMMMMMMMMM                                        
DO_DISOPRED3:            DDD..................................................................................DDDDDDDDDDDDDDD
DO_IUPRED2A:             ...............................................................................DDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDD..............................................................................DDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDD.........                     ......                     .....................DDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ............                     ......                     ...................DDDDDDDDDDDDDDDDDDDDD
RICH_[GN]:                                                                                                     GeGrsstNGN    
RICH_MOBI_[GN]:                                                                                                GeGrsstNGN    

                                          120                
AA:                      RSSLSTVSRTLEKLKPGTRGAEEC
STMI:                                            
DO_DISOPRED3:            DDDD...............D.DDD
DO_IUPRED2A:             DDD.........D.D..DDD.DDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDD........DDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDD