A8K5M9 CO062_HUMAN

Gene name: C15orf62
Protein name: Uncharacterized protein C15orf62, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell morphogenesis GO:0000902
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96AJ9 VTI1A 0.71978 catabolic process GO:0009056
membrane organization GO:0061024
protein targeting GO:0006605
...
2 Q9UK39 NOCT 0.6703 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 Q8NBT3 TMEM145 0.63879 signal transduction GO:0007165
4 Q9UK80 USP21 0.62382 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 Q96ED9 HOOK2 0.61877 cytoskeleton organization GO:0007010
cytoskeleton-dependent intracellular transport GO:0030705
protein transport GO:0015031
...
6 A6NJ64 NPIPB2 0.60816
7 Q9Y613 FHOD1 0.59816 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
8 Q99972 MYOC 0.59706 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
9 C9JG80 NPIPB4 0.58655
10 C9JXX5 C11orf94 0.58637

                                           20                  40                  60                  80                 100
AA:                      METWRKGSFRNASFFKQLSLGRPRRLRRQSSVLSQASTAGGDHEEYSNREVIRELQGRPDGRRLPLWGDEQPRATLLAPPKPPRLYRESSSCPNILEPPP
STMI:                    TTTTTTTTTTT                                                                                         
DO_DISOPRED3:            D...........................................D.................................D.....................
DO_IUPRED2A:             .........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDDDDDDDDDDDDDD.DDDDDDDDD.DDDDDDD...D...
DO_SPOTD:                DDD.DDDDDDD.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DDDDDD.....DDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDD
CONSENSUS:                          ..............DDDDDDDDDDDDDDDDDDDDDDDDDD.........DDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDD...
CONSENSUS_MOBI:                     ............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
RICH_[LP]:                                                                                          LLaPPkPPrL               
RICH_MOBI_[L]:                                                                          LpLwgdeqpratLL                       
RICH_MOBI_[P]:                                                                           PlwgdeqPratllaPPkPP                 
RICH_MOBI_[R]:                                                           ReviRelqgRpdgRRlplwgdeqpR                           
RICH_MOBI_[ER]:                                                     EEysnREviRElqgRpdgRR                                     
RICH_MOBI_[LP]:                                                                         LPLwgdeqPratLLaPPkPPrL               
RICH_MOBI_[LR]:                                                                   RpdgRRLpLwgdeqpRatLL                       

                                          120                 140                 160     
AA:                      AYTAAYSATLPSALSLSSALHQHSEKGLVDTPCFQRTPTPDLSDPFLSFKVDLGISLLEEVLQMLREQFPSEPSF
STMI:                                                                                               
DO_DISOPRED3:            ..............................DD.......................................DDDD
DO_IUPRED2A:             ..D.............D...DD....DDDDDDDDDD.......................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................DDDDD
CONSENSUS:               ..D.............D...DD....DDDDDDDDDD...................................DDDD
CONSENSUS_MOBI:          ...........................................................................