A8MZ26 EFCB9_HUMAN
Gene name: EFCAB9
Protein name: EF-hand calcium-binding domain-containing protein 9
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- developmental maturation GO:0021700
- reproduction GO:0000003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q7Z4B0 | LINC00305 | 0.98839 | |
| 2 | Q9NYU2 | UGGT1 | 0.95321 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular protein modification process GO:0006464 ... |
| 3 | P19087 | GNAT2 | 0.90429 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 4 | Q96EA4 | SPDL1 | 0.89511 | cell cycle GO:0007049 cell division GO:0051301 chromosome organization GO:0051276 ... |
| 5 | Q9Y546 | LRRC42 | 0.89161 | |
| 6 | Q14512 | FGFBP1 | 0.89136 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell population proliferation GO:0008283 ... |
| 7 | Q9NP80 | PNPLA8 | 0.8847 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 8 | Q13061 | TRDN | 0.87086 | circulatory system process GO:0003013 cytoskeleton organization GO:0007010 homeostatic process GO:0042592 ... |
| 9 | P35520 | CBS | 0.86931 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | P15918 | RAG1 | 0.86451 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
20 40 60 80 100 AA: MRLKQGSFLWYLYLDKIYCLLSVRNVKALAEYFHILDVHGKNTLNDVLFYHFLHHVTDLKKAQINIVFDMLDWNAVGEIDFEKFYMLVCMLLAHQNHLEG STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDD................................................................................................ CONSENSUS: D................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: QFMYRHSRPVFDLLDLKGDLRIGAKNFEMYRFLFNIQKQELKDLFRDFDITGDNRLNYQEFKLYTIIYTDKLQKRQKTEEKEKGERKRSLYSKCHIK STMI: DO_DISOPRED3: ..........................................................................DDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ............................................................................DDDDDDDDD............ DO_SPOTD: ......................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ..........................................................................DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ............................................................................DDDDDDDDDDDDDDDDDDDDD RICH_[K]: KteeKeKgerKrslysKchiK RICH_[EK]: KtEEKEKgErKrslysKchiK RICH_MOBI_[K]: KteeKeKgerKrslysKchiK RICH_MOBI_[EK]: KtEEKEKgErKrslysKchiK