Q7Z4B0 CR020_HUMAN

Gene name: LINC00305
Protein name: Putative uncharacterized protein encoded by LINC00305

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A8MZ26 EFCAB9 0.98839 anatomical structure development GO:0048856
cell differentiation GO:0030154
developmental maturation GO:0021700
...
2 Q9NYU2 UGGT1 0.96409 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular protein modification process GO:0006464
...
3 Q96EA4 SPDL1 0.92388 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
4 Q14512 FGFBP1 0.91364 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell population proliferation GO:0008283
...
5 Q9Y546 LRRC42 0.90332
6 P19087 GNAT2 0.90006 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
7 P16949 STMN1 0.86932 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...
8 P15918 RAG1 0.85872 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
9 Q5VX52 SPATA1 0.85374
10 P35520 CBS 0.85124 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MINLHRLCIIHVVATLLSTLLSLISVAISATCKDEKGKQEMETGQQPSGLSATLTKVKCAKRQKTVVRVRFYMLSMKNKACRKNLSKGYNQRPEGSKEES
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                       
DO_DISOPRED3:            D......D............................................................................................
DO_IUPRED2A:             ....................................DDDDDDDDDDDD....................................DDDDDDDDDDDDDDDD
DO_SPOTD:                ......................DDDDDDDDDDDDDDDDDDDDDDDDDDD..................................DDDDDDDDDDDDDDDDD
CONSENSUS:                                            .......DDDDDDDDDDDD....................................DDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                                       ......................................................DDDDDDDDDDDDDDDDD
RICH_[K]:                                                                                                                Kees
RICH_[EK]:                                                                                                            EgsKEEs
RICH_MOBI_[K]:                                                                                                           Kees
RICH_MOBI_[EK]:                                                                                                       EgsKEEs

                                 
AA:                      HMVVKEKRKGDH
STMI:                                
DO_DISOPRED3:            DDD...DDDDDD
DO_IUPRED2A:             DDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDD
RICH_[K]:                hmvvKeKrK   
RICH_[EK]:               hmvvKEKrK   
RICH_MOBI_[K]:           hmvvKeKrK   
RICH_MOBI_[EK]:          hmvvKEKrK