B1AMM8 CI107_HUMAN

Gene name: LINC00587
Protein name: Putative uncharacterized protein encoded by LINC00587

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96JB6 LOXL4 0.86378 cellular protein modification process GO:0006464
extracellular matrix organization GO:0030198
2 Q969K7 TMEM54 0.86378
3 Q7RTY0 SLC16A13 0.86378
4 Q9H857 NT5DC2 0.77259
5 P0C851 PIRT 0.70527 response to stress GO:0006950
signal transduction GO:0007165
transmembrane transport GO:0055085
...
6 Q9UFH2 DNAH17 0.70289 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
protein-containing complex assembly GO:0065003
7 Q9NP59 SLC40A1 0.70289 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 Q92187 ST8SIA4 0.65296 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
9 Q8NA42 ZNF383 0.6456 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
10 Q9H892 TTC12 0.59686

                                           20                  40                  60       
AA:                      MQFADWLHPSGWTIEILNAYGMGDRKRTNSMSKEAFTPEQLHLEKELGEMRLRPTVLHSQTDHQGFRPIPMMQ
STMI:                                                                                             
DO_DISOPRED3:            .........................................................................
DO_IUPRED2A:             ........................D.DDDDDDDDDDDDDDDDDDD.DD...DDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDD.D.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .........................................................................
RICH_[EL]:                                                EaftpEqLhLEkELgEmrLrptvL                
RICH_[MQ]:                                                                          QtdhQgfrpipMMQ