P0C851 PIRT_HUMAN

Gene name: PIRT
Protein name: Phosphoinositide-interacting protein

List of terms from Generic GO subset, which this protein is a part of:
- response to stress GO:0006950
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P14672 SLC2A4 0.8165 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cell differentiation GO:0030154
...
2 P61278 SST 0.8165 cell death GO:0008219
cell population proliferation GO:0008283
cell-cell signaling GO:0007267
...
3 Q96JB6 LOXL4 0.8165 cellular protein modification process GO:0006464
extracellular matrix organization GO:0030198
4 Q9H857 NT5DC2 0.7303
5 B1AMM8 LINC00587 0.70527
6 Q9UFH2 DNAH17 0.66441 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
protein-containing complex assembly GO:0065003
7 Q9NP59 SLC40A1 0.66441 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 Q92187 ST8SIA4 0.61721 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
9 Q8NA42 ZNF383 0.61026 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
10 Q9H892 TTC12 0.56419

                                           20                  40                  60                  80                 100
AA:                      MTMETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYRKPIVIMSVGGAILLFGVVITCLAYTLKLSDKSLSILKMVGPGFLSLG
STMI:                                                                           MMMMMMMMMMMMMMMMMMMMM                 MMMMMMM
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDD.D.......................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................                     .................       
CONSENSUS_MOBI:          .......................................................                     .................       
RICH_[EL]:                  EtLpkvLEvdEkspEakdLL                                                                             

                                          120   
AA:                      LMMLVCGLVWVPIIKKKQKHRQKSNFLRSLKSFFLTR
STMI:                    MMMMMMMMMMMMMM                       
DO_DISOPRED3:            .......................DDDDDDD.D..D.D
DO_IUPRED2A:             .....................................
DO_SPOTD:                ...............DDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                             .........DDDDDDDDDDDDDD
CONSENSUS_MOBI:                        .......................
RICH_[FL]:                                        FLrsLksFFL  
RICH_fLPS_[F]:                                   nFlrslksFF