B2CW77 KILIN_HUMAN

Gene name: KLLN
Protein name: Killin

List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cell death GO:0008219

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q86Y79 PTRH1 0.83309
2 Q9H9A6 LRRC40 0.83309
3 Q96BI1 SLC22A18 0.83194 transmembrane transport GO:0055085
transport GO:0006810
4 Q11130 FUT7 0.82946 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
5 O95484 CLDN9 0.82369 cell adhesion GO:0007155
cell junction organization GO:0034330
cellular component assembly GO:0022607
6 Q9GZZ9 UBA5 0.76921 cellular protein modification process GO:0006464
nervous system process GO:0050877
response to stress GO:0006950
...
7 Q86XM0 CATSPERD 0.75756 anatomical structure development GO:0048856
cell differentiation GO:0030154
developmental maturation GO:0021700
...
8 P05111 INHA 0.73216 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
9 O75462 CRLF1 0.72954 anatomical structure development GO:0048856
cell death GO:0008219
cell population proliferation GO:0008283
...
10 Q9NRM0 SLC2A9 0.69747 cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
transmembrane transport GO:0055085
...

                                           20                  40                  60                  80                 100
AA:                      MDRPGPGSARPGRTVHVWGYRVEWKVRNGRKLQPSEWAGRGDLGGFKRRWKDTRATVGTTFRRRSRVSLVGELSKFPLPSDSSGGKSSSSFARGALAWCR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDD....D.D......................................................................
DO_IUPRED2A:             DDDDDDDDDDDDD.................DD.DDDDDD...DD...DDD...DD.DD..DD...............DDDDDDDD.D.............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDD.............
CONSENSUS_MOBI:          ....................................................................................................
RICH_[RT]:                                                              RRwkdTRaTvgTTfR                                      
RICH_[RW]:                                                   WagRgdlggfkRRWkdtR                                              
RICH_[R]:                  RpgpgsaRpgRtvhvwgyR        RklqpsewagRgdlggfkRR                                                   
RICH_[W]:                                                    WagrgdlggfkrrW                                                  
RICH_[GR]:                 RpGpGsaRpGRtvhvwGyR        RklqpsewaGRGdlGGfkRR                                                   
RICH_[GT]:                                                       GdlGGfkrrwkdTraTvGTT                                        
RICH_[GW]:                                                   WaGrGdlGGfkrrW                                                  

                                          120                 140                 160  
AA:                      QRNPNPSCAAAETGARTSLPKERCRGWRLGNWLHKHPHPNTCPRLPACWLPPILTERGERVPKLVPLLACYPKSKPKD
STMI:                                                                                                  
DO_DISOPRED3:            .DDDDDDD...................................................................DDD
DO_IUPRED2A:             ........DDDDDDDD..............................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDD...................................................DDDDDDD
CONSENSUS:               .DDDDDDDDDDDDDDD...........................................................DDD
CONSENSUS_MOBI:          ..............................................................................