Q86Y79 PTH_HUMAN
Gene name: PTRH1
Protein name: Probable peptidyl-tRNA hydrolase
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96BI1 | SLC22A18 | 0.99862 | transmembrane transport GO:0055085 transport GO:0006810 |
| 2 | Q11130 | FUT7 | 0.99563 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 3 | O95484 | CLDN9 | 0.98872 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 4 | Q9GZZ9 | UBA5 | 0.92331 | cellular protein modification process GO:0006464 nervous system process GO:0050877 response to stress GO:0006950 ... |
| 5 | Q86XM0 | CATSPERD | 0.90934 | anatomical structure development GO:0048856 cell differentiation GO:0030154 developmental maturation GO:0021700 ... |
| 6 | P05111 | INHA | 0.87885 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 7 | O75462 | CRLF1 | 0.8757 | anatomical structure development GO:0048856 cell death GO:0008219 cell population proliferation GO:0008283 ... |
| 8 | Q9NRM0 | SLC2A9 | 0.83721 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 transmembrane transport GO:0055085 ... |
| 9 | A0A1B0GTL2 | C20orf204 | 0.83369 | |
| 10 | B2CW77 | KLLN | 0.83309 | cell cycle GO:0007049 cell death GO:0008219 |
20 40 60 80 100 AA: MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRLGVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. DO_IUPRED2A: .................DDD...........DDDDDD............................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[R]: RpggflgagqRlsRamsR RICH_[GR]: RpGGflGaGqRlsRamsR
120 140 160 180 200 AA: SVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATDLIL STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: DHIRERSQGPSLGP STMI: DO_DISOPRED3: .......DDDDDDD DO_IUPRED2A: .........DDDDD DO_SPOTD: .......DDDDDDD CONSENSUS: .......DDDDDDD CONSENSUS_MOBI: ..............