B7Z8K6 TRDC_HUMAN

Gene name: TRDC
Protein name: T cell receptor delta constant

List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376
- membrane organization GO:0061024
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O75343 GUCY1B2 0.95035 signal transduction GO:0007165
2 Q15785 TOMM34 0.90432 protein targeting GO:0006605
protein transport GO:0015031
transport GO:0006810
3 O43405 COCH 0.8934 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
4 Q9NZH5 PTTG2 0.85579 cell cycle GO:0007049
chromosome organization GO:0051276
chromosome segregation GO:0007059
...
5 P0CG35 TMSB15B 0.84564 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
protein-containing complex assembly GO:0065003
6 Q6UY01 LRRC31 0.80947
7 Q4KWH8 PLCH1 0.78472 biosynthetic process GO:0009058
catabolic process GO:0009056
homeostatic process GO:0042592
...
8 Q96QE5 TEFM 0.78163 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
generation of precursor metabolites and energy GO:0006091
9 Q9UKF2 ADAM30 0.76609 reproduction GO:0000003
10 P46013 MKI67 0.76347 cell cycle GO:0007049
cell population proliferation GO:0008283
chromosome organization GO:0051276
...

                                           20                  40                  60                  80                 100
AA:                      SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKET
STMI:                                                                                                                        
DO_DISOPRED3:            DDD.....................................................................................DDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDD................................................................D.......DDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDD.................................................................................DDDDDDDDDDDDDDD
CONSENSUS:               DDDD.................................................................................DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ......................................................................................DDDDDDDDDDDDDD
RICH_[K]:                                                                                                       KtdstdhvKpKet
RICH_[T]:                                                                                                        TdsTdhvkpkeT
RICH_[KT]:                                                                                                      KTdsTdhvKpKeT
RICH_MOBI_[K]:                                                                                                  KtdstdhvKpKet
RICH_MOBI_[T]:                                                                                                   TdsTdhvkpkeT
RICH_MOBI_[KT]:                                                                                                 KTdsTdhvKpKeT

                                          120                 140       
AA:                      ENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL
STMI:                                                 MMMMMMMMMMMMMMMMMMMMMMM 
DO_DISOPRED3:            DDDDDDD..............................................
DO_IUPRED2A:             DDDDDDDDDDDDD........................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDD................                       .
CONSENSUS_MOBI:          DDDDDDDDDDDD.................                       .
RICH_[K]:                entKqpsKschK                                         
RICH_[T]:                enT                                                  
RICH_[KT]:               enTKqpsK                                             
RICH_MOBI_[K]:           entKqpsKschK                                         
RICH_MOBI_[T]:           enT                                                  
RICH_MOBI_[KT]:          enTKqpsK