Q9NZH5 PTTG2_HUMAN

Gene name: PTTG2
Protein name: Securin-2

List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- chromosome organization GO:0051276
- chromosome segregation GO:0007059
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- reproduction GO:0000003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96RR1 TWNK 0.88571 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
2 Q8N7R0 NANOGP1 0.8764 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 Q9NZH4 PTTG3P 0.87399 cell cycle GO:0007049
chromosome organization GO:0051276
chromosome segregation GO:0007059
...
4 O14950 MYL12B 0.87171 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
5 B7Z8K6 TRDC 0.85579 immune system process GO:0002376
membrane organization GO:0061024
response to stress GO:0006950
...
6 O75343 GUCY1B2 0.83482 signal transduction GO:0007165
7 Q4KWH8 PLCH1 0.82707 biosynthetic process GO:0009058
catabolic process GO:0009056
homeostatic process GO:0042592
...
8 O43405 COCH 0.82046 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
9 Q9BYG3 NIFK 0.81713 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
10 Q92963 RIT1 0.80937 signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MATLIYVDKEIGEPGTRVAAKDVLKLESRPSIKALDGISQVLTRRFGKTYDAPSALPKATRKALGTVNRATEKSVKTNGPRKQKQPSFSAKKMTEKTVKT
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDD..DD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..................DDDDD.............................D.......DDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[K]:                                                                         KatrKalgtvnrateKsvK     KqKqpsfsaKKmteKtvKt
RICH_[T]:                                                                           TrkalgTvnraTeksvkT                       
RICH_[KT]:                                                                        KaTrKalgTvnraTeKsvKT             KKmTeKTvKT
RICH_fLPS_[K]:                                                                                            KqKqpsfsaKKmteKtvKt
RICH_MOBI_[K]:                                                                                   KsvKtngprKqKqpsfsaKKmteKtvKt
RICH_MOBI_[T]:                                                                      TrkalgTvnraTeksvkT                       
RICH_MOBI_[KT]:                                                                                                    KKmTeKTvKT
RICH_fLPS_MOBI_[K]:                                                                                       KqKqpsfsaKKmteKtvKt

                                          120                 140                 160                 180                 200
AA:                      KSSVPASDDAYPEIEKFFPFNLLDFESFDLPEERQIAHLPLSGVPLMILDEEGELEKLFQLGPPSPVKMPSPPWECNLLQSPSSILSTLDVELPAVCYDI
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDD.........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....
DO_IUPRED2A:             DDDDDD.....................................................DDDD......DDDDD..........................
DO_SPOTD:                DDDDDDDDD..........................................................................................D
CONSENSUS:               DDDDDD...............................................................DDDDD..........................
CONSENSUS_MOBI:          DDDDD...............................................................................................
RICH_[K]:                K                                                                                                   
RICH_[KT]:               K                                                                                                   
RICH_fLPS_[K]:           K                                                                                                   
RICH_MOBI_[K]:           K                                                                                                   
RICH_MOBI_[KT]:          K                                                                                                   
RICH_fLPS_MOBI_[K]:      K                                                                                                   

                                           
AA:                      DI
STMI:                      
DO_DISOPRED3:            ..
DO_IUPRED2A:             ..
DO_SPOTD:                DD
CONSENSUS:               ..
CONSENSUS_MOBI:          ..