C9J302 CD051_HUMAN
Gene name: C4orf51
Protein name: Uncharacterized protein C4orf51
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96CG3 | TIFA | 0.6515 | cellular component assembly GO:0022607 immune system process GO:0002376 protein-containing complex assembly GO:0065003 ... |
| 2 | Q9P286 | PAK5 | 0.64567 | cell cycle GO:0007049 cell death GO:0008219 cell population proliferation GO:0008283 ... |
| 3 | P23109 | AMPD1 | 0.63693 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 4 | Q9H706 | GAREM1 | 0.62716 | cell division GO:0051301 cell population proliferation GO:0008283 cellular protein modification process GO:0006464 ... |
| 5 | P78310 | CXADR | 0.58637 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 6 | Q99081 | TCF12 | 0.58615 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 7 | Q8N0S6 | CENPL | 0.55505 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
| 8 | O43865 | AHCYL1 | 0.55282 | cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 mRNA processing GO:0006397 ... |
| 9 | Q9HAI6 | TASL | 0.54547 | homeostatic process GO:0042592 |
| 10 | Q6PKX4 | DOK6 | 0.53938 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 |
20 40 60 80 100 AA: MSHYFYLTPQILLPFSPLTSQEFDLIRRKAGASWQDETRWSDSSVTTYTGSYRKKQLDKSMCSQFSFRAGQHEPECKQMSLTNSSACHLLCWAGTQETTD STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .DD..................................DD.DDDDDDD...D....D............................................ CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: IKGLFPDITRPFKKSFDVKHGVAHQIWDFGDCFPTPPNYGKYCVRPKKPAQEALINYSRRGKGVLKHLHGRCDSESKVCSSEDSEADRYSDYGWGGPSSP STMI: DO_DISOPRED3: ..........................................................................DDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .........................................................................................D.......... DO_SPOTD: ...................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ..........................................................................DDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .............................................................................DDDDDDDDDDDDDDDDDDDDDDD RICH_[S]: SSedSeadrySdygwggpSS RICH_[SY]: SSedSeadrYSdYgwggpSS RICH_[DY]: DseaDrYsDY RICH_MOBI_[SY]: SSedSeadrYSdYgwggpSS RICH_MOBI_[DY]: DseaDrYsDY
AA: FN STMI: DO_DISOPRED3: DD DO_IUPRED2A: .. DO_SPOTD: DD CONSENSUS: DD CONSENSUS_MOBI: DD