Q96CG3 TIFA_HUMAN
Gene name: TIFA
Protein name: TRAF-interacting protein with FHA domain-containing protein A
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5T6X5 | GPRC6A | 0.89494 | signal transduction GO:0007165 |
| 2 | Q7Z7C7 | STRA8 | 0.84521 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 3 | P15907 | ST6GAL1 | 0.84424 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 4 | Q8TBY0 | RBM46 | 0.83462 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 5 | Q9NRW7 | VPS45 | 0.81305 | protein transport GO:0015031 response to stress GO:0006950 transport GO:0006810 ... |
| 6 | Q13278 | RIG | 0.81305 | |
| 7 | Q8TBH0 | ARRDC2 | 0.81305 | protein transport GO:0015031 transport GO:0006810 |
| 8 | Q86WI1 | PKHD1L1 | 0.81305 | immune system process GO:0002376 |
| 9 | P23109 | AMPD1 | 0.80494 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 10 | P31358 | CD52 | 0.79443 | homeostatic process GO:0042592 |
20 40 60 80 100 AA: MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIVDS STMI: DO_DISOPRED3: DDDDDDD............................................................................................. DO_IUPRED2A: DD.................................................................................................. DO_SPOTD: DDDDDDDDDD.......................................................................................... CONSENSUS: DDDDDDD............................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: RELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQFILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMDENES STMI: DO_DISOPRED3: ...........................................................DDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .....................................................DD...............DDDDDDDDDDDDDD DO_SPOTD: ..................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .....................................................DD....DDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ................................................................DDDDDDDDDDDDDDDDDDDD RICH_[S]: SlcSSqSSSptemdeneS RICH_[SY]: YgtYSlcSSqSSS RICH_fLPS_[S]: ySlcSSqSSS