C9J6K1 CS081_HUMAN
Gene name: C19orf81
Protein name: Putative uncharacterized protein C19orf81
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BVA6 | FICD | 0.70711 | cellular protein modification process GO:0006464 response to stress GO:0006950 signal transduction GO:0007165 |
| 2 | Q9NPF2 | CHST11 | 0.70711 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 3 | Q7L775 | EPM2AIP1 | 0.70711 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 generation of precursor metabolites and energy GO:0006091 ... |
| 4 | P51793 | CLCN4 | 0.70353 | transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | Q96PP9 | GBP4 | 0.68536 | immune system process GO:0002376 response to stress GO:0006950 |
| 6 | Q13336 | SLC14A1 | 0.6396 | transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | P25800 | LMO1 | 0.6247 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 8 | Q9UNH6 | SNX7 | 0.58037 | protein transport GO:0015031 transport GO:0006810 |
| 9 | Q8NET4 | RTL9 | 0.50598 | |
| 10 | Q96ES7 | SGF29 | 0.50508 | cellular protein modification process GO:0006464 chromosome organization GO:0051276 |
20 40 60 80 100 AA: MQPEVEPVCFPAMGSPTMHRKAGALLMDLETPEEMQARSLGRPIKSSKQYLRQVIAEYEALDRELPCIRKFPTPPASQPLCLCMETLPEEDFTHLEVLQA STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD....DD...........DDDDD........................................................ DO_IUPRED2A: ......D.DDDDD.......DDDDDDDDD...D..DDDDDDD..........................D............................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD...D.DDDDDDDDD.......................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD.......DDDDDDD.......................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[M]: MgsptMhrkagallM
120 140 160 180 AA: LEAQLPGAMESGRVSSIRFENMNVICGTAGRRNRWLIAVTDFQTRSRLLRSGLSPRGLAHQIVRHDDLLLGDYRLHLRRSLVRRRMLEALGAEPNEEA STMI: DO_DISOPRED3: .............................................................................................DDDDD DO_IUPRED2A: .................................................................................................D DO_SPOTD: .................................................................................................. CONSENSUS: .................................................................................................D CONSENSUS_MOBI: ..................................................................................................