P25800 RBTN1_HUMAN
Gene name: LMO1
Protein name: Rhombotin-1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- homeostatic process GO:0042592
- immune system process GO:0002376
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6GMV3 | PTRHD1 | 0.78087 | |
| 2 | Q13336 | SLC14A1 | 0.73252 | transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | Q8WZ60 | KLHL6 | 0.6247 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 immune system process GO:0002376 ... |
| 4 | Q53H54 | TRMT12 | 0.55216 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | O43827 | ANGPTL7 | 0.54717 | anatomical structure development GO:0048856 extracellular matrix organization GO:0030198 response to stress GO:0006950 |
| 6 | Q56A73 | SPIN4 | 0.49692 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 reproduction GO:0000003 |
| 7 | Q9BVA6 | FICD | 0.44173 | cellular protein modification process GO:0006464 response to stress GO:0006950 signal transduction GO:0007165 |
| 8 | Q9NPF2 | CHST11 | 0.44173 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 9 | Q7L775 | EPM2AIP1 | 0.44173 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 generation of precursor metabolites and energy GO:0006091 ... |
| 10 | Q01959 | SLC6A3 | 0.43958 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEM STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDD................................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[M]: MMvldkedgvpM RICH_[MV]: MMVldkedgVpMlsV
120 140 AA: VMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ STMI: DO_DISOPRED3: ..................................................DDDDDD DO_IUPRED2A: ........................................................ DO_SPOTD: ..............................................DDDDDDDDDD CONSENSUS: ..................................................DDDDDD CONSENSUS_MOBI: ........................................................