C9JLW8 MCRI1_HUMAN

Gene name: MCRIP1
Protein name: Mapk-regulated corepressor-interacting protein 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P15907 ST6GAL1 0.93585 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
2 Q7Z7C7 STRA8 0.93412 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
3 Q9NPH3 IL1RAP 0.92894 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
4 Q8TBY0 RBM46 0.90248 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
5 Q6UX41 BTNL8 0.89077 immune system process GO:0002376
signal transduction GO:0007165
6 Q9UGV2 NDRG3 0.87367 cell differentiation GO:0030154
growth GO:0040007
reproduction GO:0000003
...
7 Q9NRW7 VPS45 0.86671 protein transport GO:0015031
response to stress GO:0006950
transport GO:0006810
...
8 Q8TBH0 ARRDC2 0.86671 protein transport GO:0015031
transport GO:0006810
9 Q13278 RIG 0.86671
10 Q14246 ADGRE1 0.86549 cell adhesion GO:0007155
immune system process GO:0002376
signal transduction GO:0007165

                                           20                  40                  60                  80   
AA:                      MTSSPVSRVVYNGKRTSSPRSPPSSSEIFTPAHEENVRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKVPNPSLKTFKPIDLSDLKRRSTQDAKKS
STMI:                                                                                                                     
DO_DISOPRED3:            DDDD.....DD.D.DDDDDDDDDDDDDDD..............................................................DDDDDD
DO_IUPRED2A:             ..DDDDDDDDDDDDDDDDDDDDDDDDDDDD...................DDDDDDDDDDDDDDDDDD..........DDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDD....DDDDDDDDDDDDDDD.........................DDDDDDDDD............................DDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................DDDDDDDDD............................DDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................
RICH_[S]:                  SSpvSrvvyngkrtSSprSppSSS                                                                       
RICH_fLPS_[S]:                           SSprSppSSS                                                                       
RICH_MOBI_[S]:                           SSprSppSSS