Q13278 RIG_HUMAN
Gene name: RIG
Protein name: Putative protein RIG
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NRW7 | VPS45 | 1 | protein transport GO:0015031 response to stress GO:0006950 transport GO:0006810 ... |
| 2 | P31358 | CD52 | 0.99746 | homeostatic process GO:0042592 |
| 3 | O15520 | FGF10 | 0.99673 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 4 | Q8TBY0 | RBM46 | 0.99315 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 5 | Q7Z7C7 | STRA8 | 0.95293 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 6 | P15907 | ST6GAL1 | 0.9445 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 7 | Q8N961 | ABTB2 | 0.87168 | |
| 8 | C9JLW8 | MCRIP1 | 0.86671 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 9 | Q96CG3 | TIFA | 0.81305 | cellular component assembly GO:0022607 immune system process GO:0002376 protein-containing complex assembly GO:0065003 ... |
| 10 | Q9ULB5 | CDH7 | 0.80967 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
20 40 60 80 100 AA: MPFFSSCLCPSHYSGPSLPSSTSSSLPTGPENQLGFVLLQAMVHHANSSCVRNAFWLQITEKLTPALSIIISVVYLRCPEMVENRIGFLLNVKDSKTLSV STMI: DO_DISOPRED3: D......DDDDD..DDDDDDDDDDDD.......................................................................... DO_IUPRED2A: ...................DDDDDD........................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... CONSENSUS: D......DDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[S]: ShySgpSlpSStSSS RICH_fLPS_[S]: ShySgpSlpSStSSS
AA: VGPHPKPCIL STMI: DO_DISOPRED3: .......... DO_IUPRED2A: .......... DO_SPOTD: .......... CONSENSUS: .......... CONSENSUS_MOBI: ..........