D3W0D1 KLRF2_HUMAN
Gene name: KLRF2
Protein name: Killer cell lectin-like receptor subfamily F member 2
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- immune system process GO:0002376
- protein transport GO:0015031
- response to stress GO:0006950
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8N187 | CARF | 0.7552 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q9NQ84 | GPRC5C | 0.61396 | signal transduction GO:0007165 |
| 3 | Q9NQ88 | TIGAR | 0.55815 | |
| 4 | Q9Y3A3 | MOB4 | 0.55815 | |
| 5 | Q9HD42 | CHMP1A | 0.52761 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 6 | P20592 | MX2 | 0.42865 | cell cycle GO:0007049 immune system process GO:0002376 membrane organization GO:0061024 ... |
| 7 | P21453 | S1PR1 | 0.41384 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 8 | Q9H3D4 | TP63 | 0.39219 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 9 | Q6P9G4 | TMEM154 | 0.38608 | |
| 10 | Q6QHK4 | FIGLA | 0.34259 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MENEDGYMTLSFKNRCKSKQKSKDFSLYPQYYCLLLIFGCIVILIFIMTGIDLKFWHKKMDFSQNVNVSSLSGHNYLCPNDWLLNEGKCYWFSTSFKTWK STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDD............DDDDDDDDDDDDD...........DDDDDDDDD..............D......D.............................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDD.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................ CONSENSUS: DDD............DDDDDDDDDDDDD.. ...........D......D.............................. CONSENSUS_MOBI: .............................. ...........DDDDDDDDDDDDD......................... RICH_MOBI_[SV]: SqnVnVSSlS RICH_MOBI_[NS]: SqNvNvSSlS RICH_MOBI_[NV]: NVNVsslsghN
120 140 160 180 200 AA: ESQRDCTQLQAHLLVIQNLDELEFIQNSLKPGHFGWIGLYVTFQGNLWMWIDEHFLVPELFSVIGPTDDRSCAVITGNWVYSEDCSSTFKGICQRDAILT STMI: DO_DISOPRED3: ..................................................................................................DD DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ................................................................................................DDDD
AA: HNGTSGV STMI: DO_DISOPRED3: .DDDDDD DO_IUPRED2A: ....... DO_SPOTD: .DDDDDD CONSENSUS: .DDDDDD CONSENSUS_MOBI: DDDDDDD