Q9HD42 CHM1A_HUMAN

Gene name: CHMP1A
Protein name: Charged multivesicular body protein 1a

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell division GO:0051301
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- chromosome segregation GO:0007059
- cytoskeleton organization GO:0007010
- membrane organization GO:0061024
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- protein transport GO:0015031
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y3A3 MOB4 0.94529
2 Q8TC17 GRAPL 0.94529
3 Q8N187 CARF 0.78854 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 P54619 PRKAG1 0.5603 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
...
5 Q8N7X2 STPG3 0.54981
6 D3W0D1 KLRF2 0.52761 cell-cell signaling GO:0007267
immune system process GO:0002376
protein transport GO:0015031
...
7 Q6ZUA9 MROH5 0.51068
8 P55268 LAMB2 0.47309 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
9 Q5DX21 IGSF11 0.4161 cell adhesion GO:0007155
cell-cell signaling GO:0007267
growth GO:0040007
...
10 Q9Y226 SLC22A13 0.41444 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...

                                           20                  40                  60                  80                 100
AA:                      MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKAL
STMI:                                                                                                                        
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             ....................DD...D...DD.....................................................................
DO_SPOTD:                DDDDD...............................................................................................
CONSENSUS:               D...................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140                 160                 180    
AA:                      STMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
STMI:                                                                                                                    
DO_DISOPRED3:            ..............................DDDDDDDDDDDD.........................DDDDDDDDDDDDDDD..............
DO_IUPRED2A:             .....................DD..DDD.DDDDDDDDDDDDD....DD.D.............D.......DDDDDDDDDDDD..DDDD.DDD...
DO_SPOTD:                .....................DDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .....................DDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...
CONSENSUS_MOBI:          ........................................................................DDDDDDDDDDD.............
RICH_[T]:                                         TsvmedsmssaTTlTT                                                       
RICH_MOBI_[SV]:                                                                                  SaVgeSSVrS