D6RBM5 U17LN_HUMAN
Gene name: USP17L23
Protein name: Putative ubiquitin carboxyl-terminal hydrolase 17-like protein 23
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P10114 | RAP2A | 0.70711 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 2 | Q86XS5 | ANGPTL5 | 0.58977 | |
| 3 | A4QPH2 | PI4KAP2 | 0.58124 | signal transduction GO:0007165 |
| 4 | P36896 | ACVR1B | 0.53913 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 5 | Q86VL8 | SLC47A2 | 0.45899 | transmembrane transport GO:0055085 transport GO:0006810 |
| 6 | Q8IWU4 | SLC30A8 | 0.45222 | cell-cell signaling GO:0007267 homeostatic process GO:0042592 immune system process GO:0002376 ... |
| 7 | Q6IV72 | ZNF425 | 0.40132 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | Q05066 | SRY | 0.38678 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 9 | Q9H221 | ABCG8 | 0.38246 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
| 10 | Q5JNZ3 | ZNF311 | 0.375 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MEDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSCETRVDLCDDLAPVARQLAPREKLPLSSRRPAAVGAGLQNMGNTCYVNASLQCLTY STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................. DO_IUPRED2A: ..............................DDDD............................DDDDD.DDD.DDDD.D...................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........D........................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................D........................... CONSENSUS_MOBI: .................................................................................................... RICH_[CD]: CetrvDlCDD
120 140 160 180 AA: TPPLANYMLSREHSQTCHRHKGCMLCTMQAHITRALHNPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMEKACLPGHKQV STMI: DO_DISOPRED3: ................................................................................... DO_IUPRED2A: ....................................DD........DDD...DD............................. DO_SPOTD: ...............................................................................DDDD CONSENSUS: ................................................................................... CONSENSUS_MOBI: ...................................................................................