P10114 RAP2A_HUMAN
Gene name: RAP2A
Protein name: Ras-related protein Rap-2a
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UC07 | ZNF69 | 0.70711 | |
| 2 | Q9NRM6 | IL17RB | 0.70711 | growth GO:0040007 response to stress GO:0006950 signal transduction GO:0007165 |
| 3 | Q8IWU4 | SLC30A8 | 0.63953 | cell-cell signaling GO:0007267 homeostatic process GO:0042592 immune system process GO:0002376 ... |
| 4 | Q6UXN8 | CLEC9A | 0.55216 | cell-cell signaling GO:0007267 protein transport GO:0015031 transport GO:0006810 ... |
| 5 | Q05066 | SRY | 0.54699 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 6 | Q9H4E5 | RHOJ | 0.50224 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell morphogenesis GO:0000902 ... |
| 7 | Q9HBK9 | AS3MT | 0.5 | small molecule metabolic process GO:0044281 |
| 8 | Q9P0N8 | MARCHF2 | 0.47755 | cellular protein modification process GO:0006464 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 9 | Q96GX9 | APIP | 0.47721 | biosynthetic process GO:0009058 cell death GO:0008219 cellular component assembly GO:0022607 ... |
| 10 | Q8N1N5 | CRIPAK | 0.43183 | cellular protein modification process GO:0006464 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
20 40 60 80 100 AA: MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQI STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: IRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ STMI: DO_DISOPRED3: ......................................................................DDDDDDDDDDDDD DO_IUPRED2A: ................................................................................... DO_SPOTD: ....................................................................DDDDDDDDDDDDDDD CONSENSUS: ......................................................................DDDDDDDDDDDDD CONSENSUS_MOBI: ................................................................................... RICH_[CD]: DkDDpCCsaC RICH_fLPS_[C]: dkddpCCsaC