O00253 AGRP_HUMAN

Gene name: AGRP
Protein name: Agouti-related protein

List of terms from Generic GO subset, which this protein is a part of:
- reproduction GO:0000003
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A6NI56 CCDC154 0.71945
2 P17022 ZNF18 0.65598 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 Q9BV73 CEP250 0.65251 cell cycle GO:0007049
cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
...
4 Q14980 NUMA1 0.61564 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...
5 Q86WK9 PAQR7 0.60944 anatomical structure development GO:0048856
cell differentiation GO:0030154
reproduction GO:0000003
6 Q6DT37 CDC42BPG 0.57329 cellular protein modification process GO:0006464
cytoskeleton organization GO:0007010
signal transduction GO:0007165
7 Q08379 GOLGA2 0.57002 biosynthetic process GO:0009058
catabolic process GO:0009056
cell cycle GO:0007049
...
8 Q9Y264 ANGPT4 0.5619 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
9 Q14088 RAB33A 0.55953 immune system process GO:0002376
protein transport GO:0015031
signal transduction GO:0007165
...
10 Q8N8N0 RNF152 0.55417 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
...

                                           20                  40                  60                  80                 100
AA:                      MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVP
STMI:                    SSSSSSSSSSSSSSSSSSSS                                                                                
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDD........................DDDDDDDDDDDDDDDDDD.....................
DO_IUPRED2A:             .........................DD......................D.......DD.........................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................
CONSENSUS:                                   DDDDDDDDDDDDDDDDD............D.......DDDDDDDDDDDDDDDDDDDDDD.....................
CONSENSUS_MOBI:                              ................................................................................
RICH_[AE]:                                                                         AEEdllqEAqAlAE                            
RICH_[AL]:                                                                         AeedLLqeAqALAevLdL                        
RICH_[AQ]:                                                                        QAeedllQeAQAlAevldlQ                       
RICH_[L]:                                                                              LLqeaqaLaevLdL                        
RICH_[Q]:                                                                         QaeedllQeaQalaevldlQ                       
RICH_[EL]:                                                                          EEdLLqEaqaLaEvLdL                        
RICH_[EQ]:                                                                        QaEEdllQEaQalaEvldlQ                       
RICH_[LQ]:                                                                        QaeedLLQeaQaLaevLdLQ                       

                                          120        
AA:                      CCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
STMI:                                                    
DO_DISOPRED3:            .............................DDD
DO_IUPRED2A:             ................................
DO_SPOTD:                ........................DDDDDDDD
CONSENSUS:               .............................DDD
CONSENSUS_MOBI:          ................................