Q14088 RB33A_HUMAN
Gene name: RAB33A
Protein name: Ras-related protein Rab-33A
List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UFN0 | NIPSNAP3A | 0.82725 | |
| 2 | Q9BXJ7 | AMN | 0.82725 | anatomical structure development GO:0048856 protein transport GO:0015031 small molecule metabolic process GO:0044281 ... |
| 3 | Q53S33 | BOLA3 | 0.74805 | |
| 4 | Q96SQ9 | CYP2S1 | 0.74589 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 5 | Q8TDX6 | CSGALNACT1 | 0.73992 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 6 | P05177 | CYP1A2 | 0.72309 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 7 | P08620 | FGF4 | 0.68319 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 8 | P05186 | ALPL | 0.66048 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 9 | Q9BWD3 | RTL8A | 0.61212 | |
| 10 | Q9H0N5 | PCBD2 | 0.6093 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
20 40 60 80 100 AA: MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRK STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[AL]: LghgsLqpAsAAgLAsLeLdssL RICH_[L]: LasLeLdssL
120 140 160 180 200 AA: SMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLAC STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: RLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC STMI: DO_DISOPRED3: ........DDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ....................DDDD............. DO_SPOTD: .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDD. CONSENSUS: ........DDDDDDDDDDDDDDDDDDDDDDDDDDDD. CONSENSUS_MOBI: ..................................... RICH_[Q]: QQgkvQklefpQ