O14519 CDKA1_HUMAN

Gene name: CDK2AP1
Protein name: Cyclin-dependent kinase 2-associated protein 1

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cellular protein modification process GO:0006464

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BU23 LMF2 0.66279 protein maturation GO:0051604
2 Q86SG3 DAZ4 0.56917 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 P01893 HLA-H 0.53393 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
...
4 Q8N9L1 ZIC4 0.53254 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 Q9H4X1 RGCC 0.50989 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
6 Q7RTM1 OTOP1 0.50848 anatomical structure development GO:0048856
embryo development GO:0009790
immune system process GO:0002376
...
7 Q9NQZ3 DAZ1 0.50041 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 Q96EB1 ELP4 0.49217 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
9 Q04446 GBE1 0.48585 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
generation of precursor metabolites and energy GO:0006091
10 Q9BYE2 TMPRSS13 0.47572

                                           20                  40                  60                  80                 100
AA:                      MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARG
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDDDDD.D................................................
DO_IUPRED2A:             .................DDDDDDDDDDDDDD.DDDD.........DD.DDDDDDDD.......................DDD.D................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDDDDDDDDDDD............................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................
RICH_[AH]:                       AHmpAAAlnAAgsvH                                                                             
RICH_[AM]:               MsykpnlAAhMpAAA                                                                                     
RICH_[AS]:                            AAlnAAgSvhSpStSmAtSS                                                                   
RICH_[A]:                       AAhmpAAAlnAA                                                                                 
RICH_[S]:                                    SvhSpStSmatSSqyrqllS                                                            
RICH_fLPS_[A]:           msykpnlAAhmpAAAlnAAg                                                                                
RICH_MOBI_[AH]:                  AHmpAAAlnAAgsvH                                                                             
RICH_MOBI_[AM]:          MsykpnlAAhMpAAAlnAA                                                                                 
RICH_MOBI_[AS]:                       AAlnAAgSvhSpStSmAtSS                                                                   
RICH_MOBI_[A]:                  AAhmpAAAlnAA                                                                                 
RICH_MOBI_[S]:                               SvhSpStSmatSS                                                                   
RICH_MOBI_[Y]:                                             YrqllsdYgppslgY                                                   
RICH_MOBI_[SY]:                                 SpStSmatSSqYrqllSdY                                                          
RICH_MOBI_[GY]:                                            YrqllsdYGppslGYtqGtG                                              
RICH_MOBI_[LY]:                                            YrqLLsdYgppsLgY                                                   
RICH_fLPS_MOBI_[A]:      msykpnlAAhmpAAAlnAAg                                                                                
RICH_fLPS_MOBI_[Y]:                                   atssqYrqllsdYgppslgY                                                   

                              
AA:                      LVRECLAETERNARS
STMI:                                   
DO_DISOPRED3:            ...........DDDD
DO_IUPRED2A:             ......D.D..DDDD
DO_SPOTD:                ...........DDDD
CONSENSUS:               ...........DDDD
CONSENSUS_MOBI:          ...............