Q9H4X1 RGCC_HUMAN

Gene name: RGCC
Protein name: Regulator of cell cycle RGCC

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- DNA metabolic process GO:0006259
- extracellular matrix organization GO:0030198
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BYE2 TMPRSS13 0.74335
2 P51817 PRKX 0.70253 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
3 Q96I15 SCLY 0.70028 small molecule metabolic process GO:0044281
4 P0DKB5 TPBGL 0.68516
5 Q8N9L1 ZIC4 0.67649 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
6 P0DKB6 MPC1L 0.67412 transmembrane transport GO:0055085
transport GO:0006810
7 Q8N8R3 SLC25A29 0.67232 transmembrane transport GO:0055085
transport GO:0006810
8 Q14896 MYBPC3 0.67183 anatomical structure development GO:0048856
cell adhesion GO:0007155
circulatory system process GO:0003013
...
9 Q8N4E7 FTMT 0.67073 cell population proliferation GO:0008283
homeostatic process GO:0042592
transport GO:0006810
10 Q13233 MAP3K1 0.66556 cell cycle GO:0007049
cellular protein modification process GO:0006464
immune system process GO:0002376
...

                                           20                  40                  60                  80                 100
AA:                      MKPPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTD
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDD.............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDD................................DDD.DD...DDDDDDDDDDDD....................DD...D.
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDD....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDD........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDD....................................DDDDDDDDDDDDDDDDDDDDDDDD....................
RICH_[AP]:                 PPAAqgsPAAAAAAAPA                                                                                 
RICH_[A]:                    AAqgspAAAAAAApA                                                                                 
RICH_[S]:                                                                               SSaSvSdSSgfSdSeSadSlyrnSfSfSdeklnS   
RICH_[T]:                                                                                                                  Td
RICH_[DS]:                                                                                 SvSDSSgfSDSeSaDS                  
RICH_[FS]:                                                                                           SeSadSlyrnSFSFS         
RICH_fLPS_[A]:           mkppAAqgspAAAAAAApAl                                                                                
RICH_MOBI_[A]:               AAqgspAAAAAAApA                                                                                 
RICH_MOBI_[S]:                                                                          SSaSvSdSSgfSdSeS                     
RICH_fLPS_MOBI_[A]:      mkppAAqgspAAAAAAApAl                                                                                

                                          120   
AA:                      STPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM
STMI:                                                         
DO_DISOPRED3:            DDDDDDDDDDDDDDDD.....................
DO_IUPRED2A:             DDDDDDDDDDDD.........................
DO_SPOTD:                DDDDDDDDDDDDDDDD.....................
CONSENSUS:               DDDDDDDDDDDDDDDD.....................
CONSENSUS_MOBI:          .....................................
RICH_[T]:                sTpallsaTvT