O14653 GOSR2_HUMAN

Gene name: GOSR2
Protein name: Golgi SNAP receptor complex member 2

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- membrane organization GO:0061024
- protein targeting GO:0006605
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O00339 MATN2 0.58375 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
2 Q7Z7J5 DPPA2 0.57375
3 Q96DC7 TMCO6 0.57169 nucleocytoplasmic transport GO:0006913
protein transport GO:0015031
transport GO:0006810
4 Q8N8S7 ENAH 0.53184 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
5 P33681 CD80 0.52677 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
6 Q9NUL7 DDX28 0.52626 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
ribonucleoprotein complex assembly GO:0022618
...
7 O60762 DPM1 0.5261 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
small molecule metabolic process GO:0044281
8 Q8N4N8 KIF2B 0.5254 cell cycle GO:0007049
cell division GO:0051301
chromosome segregation GO:0007059
...
9 Q9Y3A4 RRP7A 0.51825 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cellular component assembly GO:0022607
...
10 O95819 MAP4K4 0.51672 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell cycle GO:0007049
...

                                           20                  40                  60                  80                 100
AA:                      MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQ
STMI:                                                                                                                        
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             DDDDDDDDDDD...DDDDDDD....D..DD..D.....................DDDDDDDDDDDDDDD................DDDDDDDDDDDDDDD
DO_SPOTD:                DDDD...DD.DD.....DD.DDDDDDD......................................D.DDD.D...D..D.DDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDD......DDDD....D.......................................DDDD................DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[QR]:                                                                                                      QhRRhaReQQeRQ
RICH_[Q]:                                                                                                       QhrrhareQQerQ
RICH_[R]:                                                                                                         RRhaReqqeRq
RICH_[EQ]:                                                                                                      QhrrharEQQErQ
RICH_[ER]:                                                                                                        RRhaREqqERq
RICH_[HQ]:                                                                                                      QHrrHareQQerQ
RICH_[HR]:                                                                                                       HRRHaReqqeRq
RICH_fLPS_[R]:                                                                                                  qhRRhaReqqeRq

                                          120                 140                 160                 180                 200
AA:                      REELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLT
STMI:                                                                                                              MMMMMMMMMM
DO_DISOPRED3:            ......DDDDDDDDDDDDDDDDDD............................................................................
DO_IUPRED2A:             DDDDDDDDDDDDD.D....DDD..............................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DD.DD...D.DD..D.DDDDDD.DDD..D..........DDD.........DDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDD..................................................................          
CONSENSUS_MOBI:          ..........................................................................................          
RICH_[QR]:               ReellsR                                                                                             
RICH_[R]:                ReellsR                                                                                             
RICH_[T]:                       TfTTndsdTT                                                                                   
RICH_[DT]:                      TfTTnDsDTTipmD                                                                               
RICH_[EQ]:               rEE                                                                                                 
RICH_[ER]:               REEllsR                                                                                             
RICH_[HR]:               R                                                                                                   
RICH_fLPS_[R]:           ReellsR                                                                                             
RICH_fLPS_[T]:                  TfTTndsdTT                                                                                   

                                 
AA:                      CVVMFLVVQYLT
STMI:                    MMMMMMMMMMM 
DO_DISOPRED3:            ............
DO_IUPRED2A:             ............
DO_SPOTD:                DDDDDDDDDDDD
CONSENSUS:                          .
CONSENSUS_MOBI:                     .