O14653 GOSR2_HUMAN
Gene name: GOSR2
Protein name: Golgi SNAP receptor complex member 2
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- membrane organization GO:0061024
- protein targeting GO:0006605
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O00339 | MATN2 | 0.58375 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 2 | Q7Z7J5 | DPPA2 | 0.57375 | |
| 3 | Q96DC7 | TMCO6 | 0.57169 | nucleocytoplasmic transport GO:0006913 protein transport GO:0015031 transport GO:0006810 |
| 4 | Q8N8S7 | ENAH | 0.53184 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 5 | P33681 | CD80 | 0.52677 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 6 | Q9NUL7 | DDX28 | 0.52626 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ribonucleoprotein complex assembly GO:0022618 ... |
| 7 | O60762 | DPM1 | 0.5261 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 8 | Q8N4N8 | KIF2B | 0.5254 | cell cycle GO:0007049 cell division GO:0051301 chromosome segregation GO:0007059 ... |
| 9 | Q9Y3A4 | RRP7A | 0.51825 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cellular component assembly GO:0022607 ... |
| 10 | O95819 | MAP4K4 | 0.51672 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell cycle GO:0007049 ... |
20 40 60 80 100 AA: MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQ STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: DDDDDDDDDDD...DDDDDDD....D..DD..D.....................DDDDDDDDDDDDDDD................DDDDDDDDDDDDDDD DO_SPOTD: DDDD...DD.DD.....DD.DDDDDDD......................................D.DDD.D...D..D.DDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDD......DDDD....D.......................................DDDD................DDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................................................... RICH_[QR]: QhRRhaReQQeRQ RICH_[Q]: QhrrhareQQerQ RICH_[R]: RRhaReqqeRq RICH_[EQ]: QhrrharEQQErQ RICH_[ER]: RRhaREqqERq RICH_[HQ]: QHrrHareQQerQ RICH_[HR]: HRRHaReqqeRq RICH_fLPS_[R]: qhRRhaReqqeRq
120 140 160 180 200 AA: REELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLT STMI: MMMMMMMMMM DO_DISOPRED3: ......DDDDDDDDDDDDDDDDDD............................................................................ DO_IUPRED2A: DDDDDDDDDDDDD.D....DDD.............................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DD.DD...D.DD..D.DDDDDD.DDD..D..........DDD.........DDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS_MOBI: .......................................................................................... RICH_[QR]: ReellsR RICH_[R]: ReellsR RICH_[T]: TfTTndsdTT RICH_[DT]: TfTTnDsDTTipmD RICH_[EQ]: rEE RICH_[ER]: REEllsR RICH_[HR]: R RICH_fLPS_[R]: ReellsR RICH_fLPS_[T]: TfTTndsdTT
AA: CVVMFLVVQYLT STMI: MMMMMMMMMMM DO_DISOPRED3: ............ DO_IUPRED2A: ............ DO_SPOTD: DDDDDDDDDDDD CONSENSUS: . CONSENSUS_MOBI: .