O14921 RGS13_HUMAN
Gene name: RGS13
Protein name: Regulator of G-protein signaling 13
List of terms from Generic GO subset, which this protein is a part of:
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q13258 | PTGDR | 0.76234 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 homeostatic process GO:0042592 ... |
| 2 | Q96NS5 | ASB16 | 0.7604 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 3 | O75388 | GPR32 | 0.71446 | homeostatic process GO:0042592 immune system process GO:0002376 response to stress GO:0006950 ... |
| 4 | P20338 | RAB4A | 0.6528 | biosynthetic process GO:0009058 immune system process GO:0002376 protein transport GO:0015031 ... |
| 5 | O75426 | FBXO24 | 0.64386 | cellular protein modification process GO:0006464 |
| 6 | Q8TCT0 | CERK | 0.6108 | cellular nitrogen compound metabolic process GO:0034641 |
| 7 | Q96BR6 | ZNF669 | 0.60321 | |
| 8 | Q96GX9 | APIP | 0.58359 | biosynthetic process GO:0009058 cell death GO:0008219 cellular component assembly GO:0022607 ... |
| 9 | Q9NS68 | TNFRSF19 | 0.55448 | anatomical structure development GO:0048856 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 10 | Q9UBV4 | WNT16 | 0.53905 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
20 40 60 80 100 AA: MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREIN STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD............................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[R]: RRncwickmcRdeskR RICH_[CM]: MsrrnCwiCkMC RICH_[CR]: RRnCwiCkmCRdeskR RICH_fLPS_[C]: msrrnCwiCkmCrde
120 140 AA: IDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF STMI: DO_DISOPRED3: ......................................................DDDDD DO_IUPRED2A: .D...D..................................................... DO_SPOTD: .....................................................DDDDDD CONSENSUS: ......................................................DDDDD CONSENSUS_MOBI: ...........................................................