Q96GX9 MTNB_HUMAN
Gene name: APIP
Protein name: Methylthioribulose-1-phosphate dehydratase
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell death GO:0008219
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6UXN8 | CLEC9A | 0.89238 | cell-cell signaling GO:0007267 protein transport GO:0015031 transport GO:0006810 ... |
| 2 | Q9HBK9 | AS3MT | 0.8908 | small molecule metabolic process GO:0044281 |
| 3 | P60409 | KRTAP10-7 | 0.8129 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 4 | Q14525 | KRT33B | 0.79302 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 5 | Q9H4E5 | RHOJ | 0.784 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell morphogenesis GO:0000902 ... |
| 6 | P60371 | KRTAP10-6 | 0.7623 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 7 | A8MX34 | KRTAP29-1 | 0.73026 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 8 | P60411 | KRTAP10-9 | 0.72733 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 9 | Q96Q40 | CDK15 | 0.71461 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q8N1N5 | CRIPAK | 0.70725 | cellular protein modification process GO:0006464 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
20 40 60 80 100 AA: MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQPEDMFVCDINEKDISGPSPSKKLKKSQCTPL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: .............................................................D.......................DDDDD.......... DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS: DDDDDDDDDDDDDDDDD................................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[C]: CdaregdCCsrrC RICH_[CR]: RegdCCsRRC RICH_fLPS_[C]: sgCdaregdCCsrrC
120 140 160 180 200 AA: FMNAYTMRGAGAVIHTHSKAAVMATLLFPGREFKITHQEMIKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLVRRHGVYVW STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .......................................................................D..DDD....................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: GETWEKAKTMCECYDYLFDIAVSMKKVGLDPSQLPVGENGIV STMI: DO_DISOPRED3: ......................................DDDD DO_IUPRED2A: .......................................... DO_SPOTD: .......................................... CONSENSUS: .......................................... CONSENSUS_MOBI: ..........................................