O15235 RT12_HUMAN
Gene name: MRPS12
Protein name: 28S ribosomal protein S12, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q2M3D2 | EXOC3L2 | 0.99941 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 2 | P04053 | DNTT | 0.99746 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 |
| 3 | P42679 | MATK | 0.99705 | cell population proliferation GO:0008283 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 4 | Q8NCU8 | MTLN | 0.99388 | cellular component assembly GO:0022607 homeostatic process GO:0042592 protein-containing complex assembly GO:0065003 |
| 5 | Q86VU5 | COMTD1 | 0.98095 | |
| 6 | Q9BQ69 | MACROD1 | 0.90289 | cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 response to stress GO:0006950 ... |
| 7 | Q3MIX3 | ADCK5 | 0.87847 | |
| 8 | Q9GZS9 | CHST5 | 0.86491 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular protein modification process GO:0006464 ... |
| 9 | Q9NRG7 | SDR39U1 | 0.85749 | |
| 10 | O75173 | ADAMTS4 | 0.84366 | anatomical structure development GO:0048856 extracellular matrix organization GO:0030198 |
20 40 60 80 100 AA: MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGH STMI: TTTTTTTTTTTTTTTTTTTTTTTTTTTTT DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD.DDDDD.............DDDDDDDDDDDDDDD.................DDDDDDD..................... DO_IUPRED2A: ...................................DDDDDDDDDDDDDDDDDDDD.....................DDDD.................... DO_SPOTD: DDDDDDDDDDDDDDDDD............DDDDDDDDDDDDDDDDDDDDDDDDDDD............................................ CONSENSUS: ......DDDDDDDDDDDDDDDDDDDD.....................DDD..................... CONSENSUS_MOBI: D...................................................................... RICH_[PR]: RlgPPkRPPRklgPtegR RICH_[R]: RlgppkRppRklgptegR
120 AA: TLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK STMI: DO_DISOPRED3: .....................................D DO_IUPRED2A: .....DD.DD..........D................. DO_SPOTD: .................................DDDDD CONSENSUS: .....................................D CONSENSUS_MOBI: ......................................