List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- homeostatic process GO:0042592
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	P42679	MATK	0.99943	cell population proliferation GO:0008283 cellular protein modification process GO:0006464 signal transduction GO:0007165
2	P04053	DNTT	0.99923	cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950
3	Q2M3D2	EXOC3L2	0.9971	transport GO:0006810 vesicle-mediated transport GO:0016192
4	O15235	MRPS12	0.99388	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412
5	Q86VU5	COMTD1	0.9794
6	Q9BQ69	MACROD1	0.90402	cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 response to stress GO:0006950 ...
7	Q9NRG7	SDR39U1	0.87119
8	Q3MIX3	ADCK5	0.86633
9	O75173	ADAMTS4	0.85826	anatomical structure development GO:0048856 extracellular matrix organization GO:0030198
10	Q9GZS9	CHST5	0.85528	biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular protein modification process GO:0006464 ...

                                           20                  40                  60                  80                 100
AA:                      MLANDVRHQQEMWGFRKVEGGVVQSLGKSSVEGETDGTISEFREIQRLAAFASFLSHAPPLNARRLLTPPPRRRPRCTPAAAMADVSERTLQLSVLVAFA
STMI:                                                                                                              MMMMMMMMMM
DO_DISOPRED3:            DDDDD...................................................................DDDD........................
DO_IUPRED2A:             DD.......................DDD.....D..............................DDDDDDDDDDDDDDDDDD..................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDD.....................
CONSENSUS:               DDDDD....................DDD.....D..............................DDDDDDDDDDDDDDD...........          
CONSENSUS_MOBI:          ..........................................................................................          
RICH_[PR]:                                                                               RlltPPPRRRPRctP                     
RICH_[R]:                                                                                RlltpppRRRpR                        

                                          120  
AA:                      SGVLLGWQANRLRRRYLDWRKRRLQDKLAATQKKLDLA
STMI:                    MMMMMMM                               
DO_DISOPRED3:            ................................D...DD
DO_IUPRED2A:             ......................................
DO_SPOTD:                .......................D.DDDDDDDDDDDDD
CONSENSUS:                      .........................DDDDDD
CONSENSUS_MOBI:                 ...............................