Q8NCU8 MTLN_HUMAN
Gene name: MTLN
Protein name: Mitoregulin
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- homeostatic process GO:0042592
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P42679 | MATK | 0.99943 | cell population proliferation GO:0008283 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 2 | P04053 | DNTT | 0.99923 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 |
| 3 | Q2M3D2 | EXOC3L2 | 0.9971 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 4 | O15235 | MRPS12 | 0.99388 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 5 | Q86VU5 | COMTD1 | 0.9794 | |
| 6 | Q9BQ69 | MACROD1 | 0.90402 | cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 response to stress GO:0006950 ... |
| 7 | Q9NRG7 | SDR39U1 | 0.87119 | |
| 8 | Q3MIX3 | ADCK5 | 0.86633 | |
| 9 | O75173 | ADAMTS4 | 0.85826 | anatomical structure development GO:0048856 extracellular matrix organization GO:0030198 |
| 10 | Q9GZS9 | CHST5 | 0.85528 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MLANDVRHQQEMWGFRKVEGGVVQSLGKSSVEGETDGTISEFREIQRLAAFASFLSHAPPLNARRLLTPPPRRRPRCTPAAAMADVSERTLQLSVLVAFA STMI: MMMMMMMMMM DO_DISOPRED3: DDDDD...................................................................DDDD........................ DO_IUPRED2A: DD.......................DDD.....D..............................DDDDDDDDDDDDDDDDDD.................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDD..................... CONSENSUS: DDDDD....................DDD.....D..............................DDDDDDDDDDDDDDD........... CONSENSUS_MOBI: .......................................................................................... RICH_[PR]: RlltPPPRRRPRctP RICH_[R]: RlltpppRRRpR
120 AA: SGVLLGWQANRLRRRYLDWRKRRLQDKLAATQKKLDLA STMI: MMMMMMM DO_DISOPRED3: ................................D...DD DO_IUPRED2A: ...................................... DO_SPOTD: .......................D.DDDDDDDDDDDDD CONSENSUS: .........................DDDDDD CONSENSUS_MOBI: ...............................