O15492 RGS16_HUMAN
Gene name: RGS16
Protein name: Regulator of G-protein signaling 16
List of terms from Generic GO subset, which this protein is a part of:
- nervous system process GO:0050877
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8NFJ9 | BBS1 | 0.75569 | cellular component assembly GO:0022607 homeostatic process GO:0042592 nervous system process GO:0050877 ... |
| 2 | Q16836 | HADH | 0.70711 | catabolic process GO:0009056 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
| 3 | Q9Y342 | PLLP | 0.6816 | anatomical structure development GO:0048856 response to stress GO:0006950 transport GO:0006810 |
| 4 | P01893 | HLA-H | 0.59876 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 ... |
| 5 | Q7RTW8 | OTOA | 0.57472 | cell adhesion GO:0007155 nervous system process GO:0050877 |
| 6 | O95568 | METTL18 | 0.56085 | cellular protein modification process GO:0006464 |
| 7 | P15814 | IGLL1 | 0.56055 | immune system process GO:0002376 membrane organization GO:0061024 response to stress GO:0006950 ... |
| 8 | Q5MNZ9 | WIPI1 | 0.54241 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 9 | Q13641 | TPBG | 0.519 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 10 | O00155 | GPR25 | 0.48956 | signal transduction GO:0007165 |
20 40 60 80 100 AA: MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEE STMI: DO_DISOPRED3: D.D....DDDDDDD......D....DD..D.DDDDDDDDDDDDDDDDDDDDD................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: ..............................DDDDDDDDDDDDDDDDDDDDDD................................................ CONSENSUS: ...............................DDDDDDDDDDDDDDDDDDDDD................................................ CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: FKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPS STMI: DO_DISOPRED3: .....................................................................................DDDDDDDDDDDDDDD DO_IUPRED2A: ................................DDDDDDD............................................................. DO_SPOTD: ...................................................................................DDDDDDDDDDDDDDDDD CONSENSUS: .....................................................................................DDDDDDDDDDDDDDD CONSENSUS_MOBI: ........................................................................................DD.......... RICH_[AS]: AASAtlSScS
AA: HT STMI: DO_DISOPRED3: DD DO_IUPRED2A: .D DO_SPOTD: DD CONSENSUS: DD CONSENSUS_MOBI: ..