O15537 XLRS1_HUMAN
Gene name: RS1
Protein name: Retinoschisin
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P01112 | HRAS | 0.50047 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 2 | P51681 | CCR5 | 0.50047 | biological process involved in symbiotic interaction GO:0044403 cell death GO:0008219 cell-cell signaling GO:0007267 ... |
| 3 | Q9H0M5 | ZNF700 | 0.48497 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | O00522 | KRIT1 | 0.38196 | |
| 5 | P43250 | GRK6 | 0.37696 | cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 6 | Q13492 | PICALM | 0.36804 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 7 | Q9UGK8 | SERGEF | 0.34958 | |
| 8 | Q9NQA5 | TRPV5 | 0.34433 | cellular component assembly GO:0022607 homeostatic process GO:0042592 protein-containing complex assembly GO:0065003 ... |
| 9 | Q9UHQ1 | NARF | 0.34332 | |
| 10 | P07949 | RET | 0.33635 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MSRKIEGFLLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANK STMI: SSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDD....DDD..DD............................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... CONSENSUS: D............................................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................... RICH_MOBI_[AC]: ACkCdCqggpnAlwsAgA RICH_MOBI_[W]: WyqkackcdcqggpnalW RICH_MOBI_[CD]: DegeDpwyqkaCkCD RICH_MOBI_[CW]: WyqkaCkCdCqggpnalW RICH_fLPS_MOBI_[C]: stedegedpwyqkaCkCdCq
120 140 160 180 200 AA: ARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIR STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: LIPLGWHVRIAIRMELLECVSKCA STMI: DO_DISOPRED3: ........................ DO_IUPRED2A: ........................ DO_SPOTD: ....................DDDD CONSENSUS: ........................ CONSENSUS_MOBI: ........................