O43257 ZNHI1_HUMAN

Gene name: ZNHIT1
Protein name: Zinc finger HIT domain-containing protein 1

List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P13637 ATP1A3 0.71677 circulatory system process GO:0003013
homeostatic process GO:0042592
transmembrane transport GO:0055085
...
2 Q15527 SURF2 0.66743
3 Q2I0M5 RSPO4 0.65537 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
signal transduction GO:0007165
4 Q13523 PRPF4B 0.64853 cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
mRNA processing GO:0006397
5 Q14093 CYLC2 0.64805 anatomical structure development GO:0048856
cell differentiation GO:0030154
reproduction GO:0000003
6 Q9H160 ING2 0.64534 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
7 P62851 RPS25 0.63906 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 P05023 ATP1A1 0.63739 biosynthetic process GO:0009058
circulatory system process GO:0003013
homeostatic process GO:0042592
...
9 Q9NPI1 BRD7 0.63069 biosynthetic process GO:0009058
cell cycle GO:0007049
cell population proliferation GO:0008283
...
10 Q14562 DHX8 0.63003 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397

                                           20                  40                  60                  80                 100
AA:                      MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPN
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDD...............................DDD..DDDDDDDDDDDDDDDDDDDDDDDDD........................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
RICH_[D]:                                                         DDphaglpqlgkrlpqfDDDaDtgkkkkktrgD                          
RICH_[K]:                                                                    KrlpqfdddadtgKKKKK                              
RICH_[R]:                        RsqdpgqRRvldRaaRqRRinR                                                                      
RICH_[DK]:                                                                   KrlpqfDDDaDtgKKKKKtrgD                          
RICH_[DN]:                                           NrqlealeNDNfqDD                                                         
RICH_fLPS_[R]:                   RsqdpgqRRvldRaaRqRRinR                                                                      
RICH_fLPS_[D]:                                                                rlpqfDDDaD                                     
RICH_fLPS_[KD]:                                                              KrlpqfDDDaDtgKKKKK                              
RICH_fLPS_[K]:                                                             lgKrlpqfdddadtgKKKKK                              
RICH_MOBI_[D]:                                                    DDphaglpqlgkrlpqfDDDaD                                     
RICH_MOBI_[K]:                                                               KrlpqfdddadtgKKKKK                              
RICH_MOBI_[L]:                                          LeaLendnfqddphagLpqL                                                 
RICH_MOBI_[N]:                                       NrqlealeNdN                                                             
RICH_MOBI_[R]:                   RsqdpgqRRvldRaaRqRRinR                                                                      
RICH_MOBI_[DK]:                                                              KrlpqfDDDaDtgKKKKK                              
RICH_MOBI_[DL]:                                                         LpqLgkrLpqfDDD                                       
RICH_MOBI_[DN]:                                      NrqlealeNDNfqDD                                                         
RICH_fLPS_MOBI_[R]:              RsqdpgqRRvldRaaRqRRinR                                                                      
RICH_fLPS_MOBI_[K]:                                                        lgKrlpqfdddadtgKKKKK                              

                                          120                 140      
AA:                      YLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
STMI:                                                                          
DO_DISOPRED3:            ......................................................
DO_IUPRED2A:             ...DDD................................................
DO_SPOTD:                ......................................................
CONSENSUS:               ......................................................
CONSENSUS_MOBI:          ......................................................