P62851 RS25_HUMAN
Gene name: RPS25
Protein name: 40S ribosomal protein S25
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P05023 | ATP1A1 | 0.94126 | biosynthetic process GO:0009058 circulatory system process GO:0003013 homeostatic process GO:0042592 ... |
| 2 | P29144 | TPP2 | 0.89761 | cellular protein modification process GO:0006464 |
| 3 | Q9Y324 | FCF1 | 0.85904 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 4 | P24844 | MYL9 | 0.85768 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 5 | P35663 | CYLC1 | 0.85635 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 6 | Q92963 | RIT1 | 0.85121 | signal transduction GO:0007165 |
| 7 | P13637 | ATP1A3 | 0.8495 | circulatory system process GO:0003013 homeostatic process GO:0042592 transmembrane transport GO:0055085 ... |
| 8 | Q9NRQ5 | SMCO4 | 0.84646 | |
| 9 | Q14093 | CYLC2 | 0.83341 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 10 | Q9BPX6 | MICU1 | 0.8298 | cellular component assembly GO:0022607 homeostatic process GO:0042592 protein-containing complex assembly GO:0065003 ... |
20 40 60 80 100 AA: MPPKDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................. RICH_[D]: DDkkkkDagksakkDkD RICH_[K]: KddKKKKdagKsaKKdKdpvnKsggKaKKKKwsK RICH_[DK]: KDDKKKKDagKsaKKDKDpvnK RICH_fLPS_[K]: KddKKKKdagKsaKKdKdpvnKsggKaKKKKwsK RICH_MOBI_[D]: DDkkkkDagksakkDkD RICH_MOBI_[K]: KddKKKKdagKsaKKdKdpvnKsggKaKKKKwsK RICH_MOBI_[DK]: KDDKKKKDagKsaKKDKDpvnK RICH_fLPS_MOBI_[K]: KddKKKKdagKsaKKdKdpvnKsggKaKKKKwsK
120 AA: SKHRAQVIYTRNTKGGDAPAAGEDA STMI: DO_DISOPRED3: ...............DDDDDDDDDD DO_IUPRED2A: ........DDDDDD...DDDDDDDD DO_SPOTD: .............DDDDDDDDDDDD CONSENSUS: .............DDDDDDDDDDDD CONSENSUS_MOBI: ......................... RICH_[AG]: GGdApAAGedA