O43521 B2L11_HUMAN

Gene name: BCL2L11
Protein name: Bcl-2-like protein 11

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biological process involved in symbiotic interaction GO:0044403
- catabolic process GO:0009056
- cell adhesion GO:0007155
- cell cycle GO:0007049
- cell death GO:0008219
- cellular component assembly GO:0022607
- embryo development GO:0009790
- growth GO:0040007
- homeostatic process GO:0042592
- immune system process GO:0002376
- membrane organization GO:0061024
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9C0J8 WDR33 0.75748 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
2 P23246 SFPQ 0.74903 biosynthetic process GO:0009058
cell cycle GO:0007049
cell death GO:0008219
...
3 Q8TDC3 BRSK1 0.74403 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...
4 Q6ZMY3 SPOCD1 0.74182 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 Q76NI1 KNDC1 0.74016 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
6 Q5JR98 TCTEX1D4 0.73986
7 Q58A44 PCOTH 0.73713
8 Q9BRQ0 PYGO2 0.73513 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell population proliferation GO:0008283
...
9 Q9HCH0 NCKAP5L 0.73491 cytoskeleton organization GO:0007010
10 P0CG20 PRR35 0.73372

                                           20                  40                  60                  80                 100
AA:                      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD.....................D.
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............
RICH_[PQ]:                                QlQPaerPPQlrPgaPtslQ                                                               
RICH_[PR]:                            RegRqlqPaeRPPqlRPgaP                                                                   
RICH_[G]:                                                         GnpeGnhGGeGdscphGspqG                                      
RICH_[P]:                                    PaerPPqlrPgaPtslqteP               PhgsPqgPlaPPasPgP                            
RICH_[Q]:                                 QlQpaerppQlrpgaptslQ                                                               
RICH_[R]:                             RegRqlqpaeRppqlR                                                                       
RICH_[GH]:                                                            GnHGGeGdscpHG                                          
RICH_[GN]:                                                        GNpeGNhGGeG                                                
RICH_[GP]:                                            PGaPtslqtePqGnPeGnhG  GdscPhGsPqGPlaPPasPG                             
RICH_MOBI_[AP]:                                                                          APPAsPgPfA                          
RICH_MOBI_[F]:                                                                                   FatrsplFiF                  
RICH_MOBI_[G]:                                                    GnpeGnhGGeGdscphGspqG                                      
RICH_MOBI_[P]:                               PaerPPqlrPgaPtslqteP               PhgsPqgPlaPPasPgPfatrsP                      
RICH_MOBI_[Q]:                            QlQpaerppQlrpgaptslQ                                                               
RICH_MOBI_[R]:                        RegRqlqpaeRppqlR                                                                       
RICH_MOBI_[FP]:                                                                        PlaPPasPgPFatrsPlFiF                  
RICH_MOBI_[FR]:                                                                                     RsplFiFmRR               
RICH_MOBI_[GH]:                                                       GnHGGeGdscpHG                                          
RICH_MOBI_[GN]:                                                   GNpeGNhGGeG                                                
RICH_MOBI_[GP]:                                                             GdscPhGsPqGPlaPPasPG                             
RICH_fLPS_MOBI_[F]:                                                                         aspgpFatrsplFiF                  

                                          120                 140                 160                 180  
AA:                      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
STMI:                                                                                                                      
DO_DISOPRED3:            ........DDDDDDDDDDDDD..................................................DDDD.............DDDDD.....
DO_IUPRED2A:             DDDDDDDDDDDDDDDDD.D.D.............D...............................................................
DO_SPOTD:                ............DDDD..................................................................................
CONSENSUS:               ........DDDDDDDDDDDDD.............................................................................
CONSENSUS_MOBI:          ..................................................................................................