O43688 PLPP2_HUMAN
Gene name: PLPP2
Protein name: Phospholipid phosphatase 2
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cellular nitrogen compound metabolic process GO:0034641
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q9UFH2 | DNAH17 | 0.84005 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 |
2 | Q96LX8 | ZNF597 | 0.79892 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
3 | Q3SXM0 | DCAF4L1 | 0.63564 | |
4 | Q96JB6 | LOXL4 | 0.62838 | cellular protein modification process GO:0006464 extracellular matrix organization GO:0030198 |
5 | P51530 | DNA2 | 0.62838 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell cycle GO:0007049 ... |
6 | Q5T9Z0 | TEDDM1 | 0.62708 | |
7 | Q9UNK9 | ANGEL1 | 0.62498 | |
8 | P14679 | TYR | 0.60492 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
9 | P08620 | FGF4 | 0.56838 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
10 | Q99633 | PRPF18 | 0.56784 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLG STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS: DDDD .......................... ............... CONSENSUS_MOBI: .... .......................... ...............
120 140 160 180 200 AA: TFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRPTVQ STMI: MMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ...................................................... ............. CONSENSUS_MOBI: ...................................................... .............
220 240 260 280 AA: FFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS STMI: MMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ........................................................................................ DO_SPOTD: ..................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ......... .....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ......... ......................................... RICH_[L]: LkeeeLerkpsLsLtLtL RICH_[EL]: LkEEELErkpsLsLtLtLgE RICH_[LY]: LsLtLtLgeadhnhYgY