P08620 FGF4_HUMAN

Gene name: FGF4
Protein name: Fibroblast growth factor 4

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cell division GO:0051301
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- embryo development GO:0009790
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UNK9 ANGEL1 0.7765
2 P05186 ALPL 0.76014 anatomical structure development GO:0048856
cell differentiation GO:0030154
reproduction GO:0000003
3 Q8NAT1 POMGNT2 0.73036 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 A6NIE6 RRN3P2 0.72738 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 Q14088 RAB33A 0.68319 immune system process GO:0002376
protein transport GO:0015031
signal transduction GO:0007165
...
6 Q9H0N5 PCBD2 0.68269 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
7 P05177 CYP1A2 0.66704 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 Q9UFH2 DNAH17 0.66408 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
protein-containing complex assembly GO:0065003
9 Q96SQ9 CYP2S1 0.64408 catabolic process GO:0009056
small molecule metabolic process GO:0044281
10 Q53S33 BOLA3 0.63649

                                           20                  40                  60                  80                 100
AA:                      MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALP
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                      
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...D.DD...D.DDDDDDDDDDDDDDD.............................
DO_IUPRED2A:             ...............................D.DDD................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................
CONSENSUS:                                             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................
CONSENSUS_MOBI:                                        ......................................................................
RICH_[AL]:                                                         LerrwesLvALsLArLpvAAqpkeAA                                
RICH_[A]:                                                                   AlslArlpvAAqpkeAA                                
RICH_[L]:                                                      LeaeLerrwesLvaLsLarL                                          
RICH_[EL]:                                                     LEaELErrwEsLvaLsLarL                                          

                                          120                 140                 160                 180                 200
AA:                      DGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVT
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             .........................................................................................DDD........
DO_SPOTD:                .........................................................................................DDDDDDDDD..
CONSENSUS:               .........................................................................................DDD........
CONSENSUS_MOBI:          ....................................................................................................

                                       
AA:                      HFLPRL
STMI:                          
DO_DISOPRED3:            ......
DO_IUPRED2A:             ......
DO_SPOTD:                ......
CONSENSUS:               ......
CONSENSUS_MOBI:          ......