O43920 NDUS5_HUMAN

Gene name: NDUFS5
Protein name: NADH dehydrogenase [ubiquinone] iron-sulfur protein 5

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- generation of precursor metabolites and energy GO:0006091
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P08246 ELANE 0.69264 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
2 Q9P283 SEMA5B 0.60604 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
3 Q9Y2X0 MED16 0.57975 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 O75106 AOC2 0.56294 nervous system process GO:0050877
5 Q8IZL9 CDK20 0.53625 anatomical structure development GO:0048856
cell cycle GO:0007049
cell division GO:0051301
...
6 Q9NUT2 ABCB8 0.52578 transmembrane transport GO:0055085
transport GO:0006810
7 Q9NRG9 AAAS 0.50177 biological process involved in symbiotic interaction GO:0044403
carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
...
8 Q05932 FPGS 0.49725 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell population proliferation GO:0008283
...
9 Q96KN4 LRATD1 0.49447 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
10 Q96KT7 SLC35G5 0.44721

                                           20                  40                  60                  80                 100
AA:                      MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIG
STMI:                                                                                                                        
DO_DISOPRED3:            ..................................................................................................DD
DO_IUPRED2A:             ..............................................................................DDD...DDDDDDDDDDDDDDDD
DO_SPOTD:                DD......................................................................................DDDDDDDDDDDD
CONSENSUS:               ........................................................................................DDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[HP]:                                                                                                            PPPHHig

                                       
AA:                      KGEPRP
STMI:                          
DO_DISOPRED3:            DDDDDD
DO_IUPRED2A:             DDDDDD
DO_SPOTD:                DDDDDD
CONSENSUS:               DDDDDD
CONSENSUS_MOBI:          .....D
RICH_[HP]:               kgePrP