P08246 ELNE_HUMAN
Gene name: ELANE
Protein name: Neutrophil elastase
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell adhesion GO:0007155
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- extracellular matrix organization GO:0030198
- homeostatic process GO:0042592
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9P283 | SEMA5B | 0.78706 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 2 | O43920 | NDUFS5 | 0.69264 | cellular component assembly GO:0022607 generation of precursor metabolites and energy GO:0006091 protein-containing complex assembly GO:0065003 |
| 3 | O75106 | AOC2 | 0.68451 | nervous system process GO:0050877 |
| 4 | Q05932 | FPGS | 0.61994 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 5 | Q9NUT2 | ABCB8 | 0.60696 | transmembrane transport GO:0055085 transport GO:0006810 |
| 6 | Q8IZL9 | CDK20 | 0.56952 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell division GO:0051301 ... |
| 7 | O75871 | CEACAM4 | 0.56208 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 8 | Q96KN4 | LRATD1 | 0.55939 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 |
| 9 | Q96KT7 | SLC35G5 | 0.55756 | |
| 10 | Q8N808 | SLC35G3 | 0.52312 |
20 40 60 80 100 AA: MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFA STMI: SSSSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS: ......................................................................... CONSENSUS_MOBI: .........................................................................
120 140 160 180 200 AA: VQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFG STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 260 AA: DSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH STMI: DO_DISOPRED3: ..................................................DDDDDDDDDDDDDDDDD DO_IUPRED2A: ...................................................DDDDDDDDDDDDDDDD DO_SPOTD: .................................................DDDDDDDDDDDDDDDDDD CONSENSUS: ..................................................DDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ................................................................... RICH_[P]: PcPhPrdPdP RICH_[DP]: DnPcPhPrDPDP RICH_[HP]: PcPHPrdPdPasrtH