O60565 GREM1_HUMAN

Gene name: GREM1
Protein name: Gremlin-1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- developmental maturation GO:0021700
- DNA metabolic process GO:0006259
- embryo development GO:0009790
- extracellular matrix organization GO:0030198
- growth GO:0040007
- immune system process GO:0002376
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O00425 IGF2BP3 0.75727 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
2 P48549 KCNJ3 0.68532 cell-cell signaling GO:0007267
circulatory system process GO:0003013
transmembrane transport GO:0055085
...
3 O75339 CILP 0.66054 signal transduction GO:0007165
4 Q9NY57 STK32B 0.62721 cellular protein modification process GO:0006464
signal transduction GO:0007165
5 P02810 PRH1; 0.61283
6 Q13356 PPIL2 0.59895 cellular protein modification process GO:0006464
immune system process GO:0002376
protein folding GO:0006457
7 Q5XKR4 OTP 0.59175 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell population proliferation GO:0008283
8 Q9Y385 UBE2J1 0.59044 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
9 P49901 SMCP 0.58938 reproduction GO:0000003
10 Q92896 GLG1 0.57551 anatomical structure development GO:0048856
cell differentiation GO:0030154
immune system process GO:0002376
...

                                           20                  40                  60                  80                 100
AA:                      MSRTAYTVGALLLLLGTLLPAAEGKKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGRGQGRGTAMPGEEVLESSQEALHVTERKYLKRDWCKTQPLK
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSS                                                                            
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................
DO_IUPRED2A:             .......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................
CONSENSUS:                                       DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................
CONSENSUS_MOBI:                                  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................
RICH_[PQ]:                                                PPPdkaQhndseQtQsPQQP                                               
RICH_[QR]:                                                            QtQspQQpgsRnRgRgQgR                                    
RICH_[G]:                                                                     GsrnrGrGqGrGtampG                              
RICH_[K]:                                        KKKgsqgaipppdK                                                              
RICH_[Q]:                                             QgaipppdkaQhndseQtQspQQ                                                
RICH_[GQ]:                                                            QtQspQQpGsrnrGrGQGrG                                   
RICH_[GR]:                                                                    GsRnRGRGqGRGtampG                              
RICH_fLPS_[Q]:                                                kaQhndseQtQspQQ                                                
RICH_MOBI_[QR]:                                                       QtQspQQpgsRnRgRgQgR                                    
RICH_MOBI_[G]:                                                                GsrnrGrGqGrGtampG                              
RICH_MOBI_[K]:                                   KKKgsqgaipppdK                                                              
RICH_MOBI_[Q]:                                        QgaipppdkaQhndseQtQspQQ                                                
RICH_MOBI_[GQ]:                                                       QtQspQQpGsrnrGrGQGrG                                   
RICH_MOBI_[GR]:                                                               GsRnRGRGqGRGtampG                              
RICH_fLPS_MOBI_[Q]:                                           kaQhndseQtQspQQ                                                

                                          120                 140                 160                 180                
AA:                      QTIHEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD
STMI:                                                                                                        
DO_DISOPRED3:            ....................................................................................
DO_IUPRED2A:             .....D..............................................................................
DO_SPOTD:                ....................................................................................
CONSENSUS:               ....................................................................................
CONSENSUS_MOBI:          ....................................................................................