O60739 EIF1B_HUMAN
Gene name: EIF1B
Protein name: Eukaryotic translation initiation factor 1b
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P10082 | PYY | 0.99906 | anatomical structure development GO:0048856 cell differentiation GO:0030154 signal transduction GO:0007165 |
| 2 | Q9UMX5 | NENF | 0.77466 | cell death GO:0008219 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 3 | Q53GT1 | KLHL22 | 0.7589 | catabolic process GO:0009056 cell cycle GO:0007049 cell division GO:0051301 ... |
| 4 | Q9NZC2 | TREM2 | 0.71695 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q9Y2U9 | KLHDC2 | 0.67572 | |
| 6 | Q13618 | CUL3 | 0.67572 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 7 | P35221 | CTNNA1 | 0.66044 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 8 | Q5TGI0 | FAXC | 0.62964 | |
| 9 | Q9UGR2 | ZC3H7B | 0.62893 | biological process involved in symbiotic interaction GO:0044403 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | Q8NHV4 | NEDD1 | 0.62804 | cell cycle GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
20 40 60 80 100 AA: MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEV STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDD........DDDDDDDDDD............................................................................... CONSENSUS: D................................................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ RICH_MOBI_[D]: DpfaDatkgDD RICH_MOBI_[DF]: FDpFaDatkgDD
AA: GIVKEEQLKVHGF STMI: DO_DISOPRED3: ............. DO_IUPRED2A: ............. DO_SPOTD: ............. CONSENSUS: ............. CONSENSUS_MOBI: .............