Q9NZC2 TREM2_HUMAN

Gene name: TREM2
Protein name: Triggering receptor expressed on myeloid cells 2

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell death GO:0008219
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- membrane organization GO:0061024
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q53GT1 KLHL22 0.75712 catabolic process GO:0009056
cell cycle GO:0007049
cell division GO:0051301
...
2 P10082 PYY 0.71763 anatomical structure development GO:0048856
cell differentiation GO:0030154
signal transduction GO:0007165
3 O60739 EIF1B 0.71695
4 Q9UMX5 NENF 0.55529 cell death GO:0008219
cellular protein modification process GO:0006464
signal transduction GO:0007165
5 Q6P3X8 PGBD2 0.55169
6 Q13237 PRKG2 0.50744 cellular protein modification process GO:0006464
signal transduction GO:0007165
transport GO:0006810
7 Q9Y2U9 KLHDC2 0.50744
8 Q6ULP2 AFTPH 0.50161 protein transport GO:0015031
transport GO:0006810
9 Q8IZU3 SYCP3 0.47817 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...
10 P35221 CTNNA1 0.4744 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...

                                           20                  40                  60                  80                 100
AA:                      MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNL
STMI:                    SSSSSSSSSSSSSSSSSS                                                                                  
DO_DISOPRED3:            DDDDDDDDDDDDDDDD..D.................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:                                 ..................................................................................
CONSENSUS_MOBI:                            ..................................................................................

                                          120                 140                 160                 180                 200
AA:                      QPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHG
STMI:                                                                                              MMMMMMMMMMMMMMMMMMMMM     
DO_DISOPRED3:            ....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDD.
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                .................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD                     DDDDD
CONSENSUS_MOBI:          ...............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD                     .....
RICH_[EH]:                                                              EsfEdaHvEH                                           
RICH_[GP]:                                                                                                                  G
RICH_MOBI_[D]:                                            DhrDagDlwfpgesesfeD                                                
RICH_MOBI_[DF]:                                           DhrDagDlwFpgesesFeD                                                
RICH_MOBI_[EF]:                                                    FpgEsEsFEdahvE                                            
RICH_MOBI_[EI]:                                                            EdahvEhsIsrsllEgEI                                

                                          220          
AA:                      QKPGTHPPSELDCGHDPGYQLQTLPGLRDT
STMI:                                                  
DO_DISOPRED3:            ..DDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ....DDDDDDDDDDDD.......D......
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..............................
RICH_[GP]:               qkPGthPPseldcGhdPG